Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427Y4B0

Protein Details
Accession A0A427Y4B0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYTKGRILGHKRGKRNSRPNQSLVHydrophilic
NLS Segment(s)
PositionSequence
15-20HKRGKR
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYTKGRILGHKRGKRNSRPNQSLVAIEGVDSKETARSYLGKRIAYVYKAKREINGSRVRVIWGRISRPHGNSGVVKGKFATNLPAKVFGASCRIMLFPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.8
12 0.75
13 0.66
14 0.56
15 0.47
16 0.37
17 0.26
18 0.19
19 0.17
20 0.12
21 0.1
22 0.09
23 0.08
24 0.09
25 0.09
26 0.1
27 0.09
28 0.13
29 0.15
30 0.22
31 0.27
32 0.25
33 0.25
34 0.28
35 0.29
36 0.27
37 0.33
38 0.3
39 0.32
40 0.36
41 0.36
42 0.35
43 0.38
44 0.39
45 0.39
46 0.43
47 0.38
48 0.36
49 0.36
50 0.35
51 0.32
52 0.3
53 0.29
54 0.24
55 0.26
56 0.29
57 0.35
58 0.38
59 0.39
60 0.41
61 0.36
62 0.36
63 0.33
64 0.35
65 0.37
66 0.32
67 0.3
68 0.27
69 0.27
70 0.25
71 0.24
72 0.26
73 0.23
74 0.27
75 0.29
76 0.32
77 0.31
78 0.31
79 0.31
80 0.25
81 0.24
82 0.21
83 0.2
84 0.17
85 0.17
86 0.16