Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427XP03

Protein Details
Accession A0A427XP03    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPPRQAKKTPTTSRRHKKPSRPHLNLRTTEGHydrophilic
NLS Segment(s)
PositionSequence
8-21KTPTTSRRHKKPSR
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 8.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPPRQAKKTPTTSRRHKKPSRPHLNLRTTEGTSRGMPAPPQTPPTLPITPTTQDSSSVSFTLPSPASGPTQATSSSLSRSLKRPRPDTPYPARGGRARSTDDSLTPPPASTDSPPPSVGANSGADTAANSNKRPRVDTGMPPPRNQVSVPVPALVDDLFSPQLHAPHAPPLPPPTASGAQWTNTEHVGLFRHVSAHGATRWGDAVPGKTASESEAAWRDTVEPFIVAQLLSKGGPGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.91
5 0.93
6 0.94
7 0.94
8 0.92
9 0.92
10 0.92
11 0.91
12 0.84
13 0.8
14 0.74
15 0.65
16 0.58
17 0.5
18 0.42
19 0.33
20 0.32
21 0.27
22 0.23
23 0.22
24 0.24
25 0.25
26 0.25
27 0.27
28 0.27
29 0.26
30 0.26
31 0.31
32 0.3
33 0.27
34 0.27
35 0.28
36 0.28
37 0.3
38 0.31
39 0.24
40 0.24
41 0.24
42 0.25
43 0.22
44 0.2
45 0.17
46 0.15
47 0.14
48 0.17
49 0.16
50 0.13
51 0.13
52 0.14
53 0.15
54 0.15
55 0.16
56 0.12
57 0.13
58 0.13
59 0.13
60 0.14
61 0.14
62 0.14
63 0.18
64 0.2
65 0.21
66 0.28
67 0.37
68 0.41
69 0.48
70 0.52
71 0.53
72 0.6
73 0.63
74 0.65
75 0.63
76 0.63
77 0.59
78 0.55
79 0.52
80 0.47
81 0.45
82 0.4
83 0.35
84 0.32
85 0.31
86 0.32
87 0.29
88 0.27
89 0.27
90 0.24
91 0.23
92 0.19
93 0.17
94 0.14
95 0.15
96 0.15
97 0.13
98 0.19
99 0.19
100 0.21
101 0.21
102 0.21
103 0.2
104 0.19
105 0.18
106 0.12
107 0.1
108 0.09
109 0.09
110 0.08
111 0.07
112 0.07
113 0.08
114 0.1
115 0.11
116 0.11
117 0.15
118 0.19
119 0.2
120 0.22
121 0.24
122 0.28
123 0.31
124 0.36
125 0.43
126 0.5
127 0.51
128 0.49
129 0.5
130 0.43
131 0.4
132 0.34
133 0.29
134 0.22
135 0.25
136 0.25
137 0.23
138 0.21
139 0.2
140 0.2
141 0.14
142 0.11
143 0.06
144 0.07
145 0.08
146 0.08
147 0.09
148 0.09
149 0.1
150 0.11
151 0.12
152 0.11
153 0.17
154 0.18
155 0.18
156 0.19
157 0.22
158 0.23
159 0.23
160 0.23
161 0.22
162 0.23
163 0.22
164 0.25
165 0.23
166 0.22
167 0.23
168 0.24
169 0.2
170 0.18
171 0.18
172 0.13
173 0.13
174 0.14
175 0.14
176 0.14
177 0.12
178 0.13
179 0.13
180 0.14
181 0.13
182 0.15
183 0.15
184 0.16
185 0.16
186 0.16
187 0.17
188 0.15
189 0.16
190 0.15
191 0.16
192 0.16
193 0.17
194 0.17
195 0.16
196 0.16
197 0.16
198 0.16
199 0.14
200 0.16
201 0.19
202 0.2
203 0.2
204 0.2
205 0.2
206 0.19
207 0.21
208 0.17
209 0.12
210 0.11
211 0.12
212 0.12
213 0.1
214 0.1
215 0.1
216 0.11
217 0.1
218 0.12