Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427XN34

Protein Details
Accession A0A427XN34    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
107-126ATVKRKTSVVKKFKDRVVKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MPVRPTTNSNSAPTSASATGTRNSPAREYPPETYESAVEELEPEPLPLPSSSRIAGAEHFRRGSAPAFGPRKDLPSPPVGPVMPDFHDMVDHRRRVSAANADDAGVATVKRKTSVVKKFKDRVVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.23
4 0.21
5 0.2
6 0.21
7 0.2
8 0.22
9 0.21
10 0.23
11 0.23
12 0.25
13 0.29
14 0.34
15 0.38
16 0.38
17 0.37
18 0.38
19 0.36
20 0.33
21 0.28
22 0.23
23 0.18
24 0.15
25 0.12
26 0.1
27 0.1
28 0.11
29 0.1
30 0.08
31 0.08
32 0.08
33 0.09
34 0.08
35 0.1
36 0.1
37 0.12
38 0.12
39 0.12
40 0.13
41 0.12
42 0.14
43 0.18
44 0.2
45 0.2
46 0.2
47 0.19
48 0.19
49 0.19
50 0.18
51 0.14
52 0.13
53 0.19
54 0.22
55 0.22
56 0.26
57 0.25
58 0.28
59 0.28
60 0.28
61 0.23
62 0.26
63 0.27
64 0.25
65 0.27
66 0.23
67 0.22
68 0.22
69 0.22
70 0.17
71 0.17
72 0.16
73 0.13
74 0.16
75 0.16
76 0.21
77 0.26
78 0.26
79 0.25
80 0.26
81 0.27
82 0.26
83 0.31
84 0.33
85 0.27
86 0.29
87 0.29
88 0.28
89 0.27
90 0.25
91 0.2
92 0.12
93 0.1
94 0.08
95 0.11
96 0.12
97 0.13
98 0.15
99 0.21
100 0.31
101 0.42
102 0.5
103 0.57
104 0.66
105 0.72
106 0.79