Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427YBG5

Protein Details
Accession A0A427YBG5   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-40AERKERRKVTNANSQKKNKHLRAKKKAIRKAGIBasic
NLS Segment(s)
PositionSequence
10-38RKERRKVTNANSQKKNKHLRAKKKAIRKA
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences MAGAMSEAERKERRKVTNANSQKKNKHLRAKKKAIRKAGISDAQKALEAAEQTARSALGRARRGSAAPEVVARRRAELDACLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.63
4 0.68
5 0.75
6 0.77
7 0.79
8 0.81
9 0.78
10 0.78
11 0.81
12 0.79
13 0.79
14 0.79
15 0.81
16 0.83
17 0.88
18 0.86
19 0.86
20 0.84
21 0.82
22 0.77
23 0.69
24 0.62
25 0.58
26 0.57
27 0.48
28 0.43
29 0.35
30 0.31
31 0.27
32 0.22
33 0.16
34 0.11
35 0.1
36 0.08
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.11
45 0.16
46 0.22
47 0.23
48 0.25
49 0.27
50 0.27
51 0.29
52 0.31
53 0.26
54 0.22
55 0.25
56 0.27
57 0.3
58 0.35
59 0.32
60 0.3
61 0.3
62 0.31
63 0.28