FuNGI

A0A427Y0P5

Protein Details

Accession

A0A427Y0P5

Localization Confidence

High

Confidence Score

24.9

NoLS Segment(s)

Position	Sequence	Protein Nature
287-312	DSSAYSRSPSRRRRSRSRDITRSDIF	Hydrophilic
332-364	PEYAAEVGRRDKRRRRKEQRARARERKREAASA	Basic
439-460	LIAERKRKALREQLLSRKKAKT	Hydrophilic

NLS Segment(s)

Position	Sequence
297-302	RRRRSR
340-360	RRDKRRRRKEQRARARERKRE
438-458	KLIAERKRKALREQLLSRKKA

Subcellular Location(s)

nucl 23, mito 2, cyto 2, cyto_mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR018957 Znf_C3HC4_RING-type IPR001841 Znf_RING IPR013083 Znf_RING/FYVE/PHD IPR017907 Znf_RING_CS
Gene Ontology	GO:0046872 F:metal ion binding
Pfam	View protein in Pfam PF00097 zf-C3HC4
PROSITE	View protein in PROSITE PS00518 ZF_RING_1 PS50089 ZF_RING_2

Amino Acid Sequences

MSNAAAGPSSVAGPTHAAADNVVDEDADKERCCICLTTLVDRTAAGECGHEFCFTCIGVWANQSRRCPLCNAPMSDCLLHDLGSAMPTKFFLPPLPERPFARRRVASPSPTRKDAWRAEQAAVARRRDVYARGLFAKHVASNGYTGFRANPSPRDITKDGATAERARLFLRRELRVWAPPDDVDGLVDHIVAFLRSVDVRSEASVRFLEPLVDETYPQAAEHLAHELYAFLRSPYAELAAYDEVVQYDLQPSRPFLEAQRGRLSSHSLSATSSGRSESRGRSHSSDDSSAYSRSPSRRRRSRSRDITRSDIFRPEPARGERRWDQADSWVDPEYAAEVGRRDKRRRRKEQRARARERKREAASAAALAVDHGLTLDPAIPAAGINIKGAAERRQSLLERLAIAKGHVSDIVSDASAETPPPATPPPDSEQRAKELRDKLIAERKRKALREQLLSRKKAKTGEEELSEEAVAVVP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.13
3	0.13
4	0.13
5	0.13
6	0.14
7	0.14
8	0.13
9	0.12
10	0.09
11	0.08
12	0.1
13	0.14
14	0.15
15	0.14
16	0.16
17	0.17
18	0.18
19	0.2
20	0.2
21	0.18
22	0.24
23	0.27
24	0.33
25	0.38
26	0.38
27	0.36
28	0.34
29	0.34
30	0.27
31	0.25
32	0.17
33	0.13
34	0.13
35	0.16
36	0.17
37	0.16
38	0.15
39	0.14
40	0.16
41	0.15
42	0.14
43	0.13
44	0.14
45	0.14
46	0.18
47	0.24
48	0.3
49	0.35
50	0.37
51	0.42
52	0.43
53	0.44
54	0.44
55	0.44
56	0.46
57	0.49
58	0.51
59	0.49
60	0.5
61	0.51
62	0.47
63	0.4
64	0.33
65	0.26
66	0.21
67	0.17
68	0.14
69	0.1
70	0.11
71	0.13
72	0.1
73	0.1
74	0.11
75	0.12
76	0.13
77	0.13
78	0.15
79	0.19
80	0.26
81	0.34
82	0.39
83	0.42
84	0.44
85	0.51
86	0.56
87	0.56
88	0.58
89	0.53
90	0.5
91	0.55
92	0.59
93	0.6
94	0.63
95	0.67
96	0.64
97	0.64
98	0.63
99	0.58
100	0.6
101	0.58
102	0.55
103	0.53
104	0.5
105	0.47
106	0.49
107	0.47
108	0.47
109	0.46
110	0.39
111	0.32
112	0.3
113	0.3
114	0.29
115	0.29
116	0.28
117	0.26
118	0.28
119	0.3
120	0.3
121	0.28
122	0.28
123	0.28
124	0.2
125	0.17
126	0.15
127	0.12
128	0.13
129	0.14
130	0.14
131	0.12
132	0.12
133	0.12
134	0.12
135	0.16
136	0.18
137	0.21
138	0.23
139	0.28
140	0.28
141	0.35
142	0.35
143	0.33
144	0.32
145	0.31
146	0.28
147	0.24
148	0.26
149	0.2
150	0.22
151	0.21
152	0.19
153	0.18
154	0.21
155	0.21
156	0.25
157	0.29
158	0.3
159	0.29
160	0.32
161	0.35
162	0.36
163	0.37
164	0.33
165	0.28
166	0.25
167	0.26
168	0.23
169	0.19
170	0.14
171	0.11
172	0.09
173	0.08
174	0.07
175	0.06
176	0.05
177	0.05
178	0.04
179	0.04
180	0.03
181	0.04
182	0.04
183	0.05
184	0.06
185	0.07
186	0.08
187	0.08
188	0.11
189	0.1
190	0.12
191	0.12
192	0.12
193	0.11
194	0.11
195	0.1
196	0.08
197	0.1
198	0.1
199	0.1
200	0.1
201	0.09
202	0.1
203	0.1
204	0.09
205	0.07
206	0.06
207	0.06
208	0.06
209	0.08
210	0.07
211	0.06
212	0.07
213	0.07
214	0.07
215	0.07
216	0.07
217	0.04
218	0.05
219	0.05
220	0.06
221	0.06
222	0.06
223	0.05
224	0.05
225	0.08
226	0.08
227	0.08
228	0.07
229	0.07
230	0.06
231	0.07
232	0.07
233	0.04
234	0.07
235	0.08
236	0.09
237	0.09
238	0.1
239	0.12
240	0.13
241	0.13
242	0.12
243	0.22
244	0.23
245	0.27
246	0.32
247	0.31
248	0.31
249	0.31
250	0.34
251	0.24
252	0.24
253	0.21
254	0.15
255	0.14
256	0.16
257	0.16
258	0.13
259	0.13
260	0.11
261	0.11
262	0.13
263	0.16
264	0.18
265	0.23
266	0.26
267	0.29
268	0.31
269	0.35
270	0.36
271	0.36
272	0.33
273	0.28
274	0.28
275	0.26
276	0.24
277	0.2
278	0.18
279	0.19
280	0.24
281	0.33
282	0.4
283	0.49
284	0.58
285	0.66
286	0.76
287	0.81
288	0.85
289	0.87
290	0.88
291	0.87
292	0.82
293	0.81
294	0.74
295	0.69
296	0.6
297	0.54
298	0.44
299	0.4
300	0.36
301	0.31
302	0.33
303	0.35
304	0.39
305	0.34
306	0.41
307	0.41
308	0.46
309	0.47
310	0.43
311	0.38
312	0.39
313	0.43
314	0.36
315	0.33
316	0.27
317	0.24
318	0.22
319	0.21
320	0.14
321	0.1
322	0.09
323	0.08
324	0.08
325	0.15
326	0.23
327	0.32
328	0.4
329	0.49
330	0.6
331	0.71
332	0.81
333	0.85
334	0.89
335	0.92
336	0.94
337	0.96
338	0.96
339	0.96
340	0.95
341	0.95
342	0.93
343	0.89
344	0.88
345	0.8
346	0.74
347	0.65
348	0.6
349	0.5
350	0.41
351	0.33
352	0.24
353	0.19
354	0.13
355	0.12
356	0.06
357	0.04
358	0.04
359	0.04
360	0.03
361	0.04
362	0.05
363	0.05
364	0.05
365	0.05
366	0.05
367	0.05
368	0.06
369	0.08
370	0.07
371	0.08
372	0.08
373	0.08
374	0.1
375	0.12
376	0.17
377	0.19
378	0.21
379	0.23
380	0.27
381	0.29
382	0.31
383	0.34
384	0.31
385	0.28
386	0.28
387	0.28
388	0.23
389	0.22
390	0.21
391	0.17
392	0.16
393	0.14
394	0.13
395	0.12
396	0.13
397	0.13
398	0.11
399	0.1
400	0.09
401	0.09
402	0.09
403	0.09
404	0.08
405	0.08
406	0.08
407	0.11
408	0.14
409	0.15
410	0.17
411	0.23
412	0.28
413	0.36
414	0.41
415	0.44
416	0.46
417	0.5
418	0.54
419	0.52
420	0.55
421	0.53
422	0.53
423	0.53
424	0.52
425	0.54
426	0.58
427	0.63
428	0.63
429	0.64
430	0.68
431	0.7
432	0.73
433	0.73
434	0.73
435	0.74
436	0.76
437	0.78
438	0.79
439	0.8
440	0.81
441	0.8
442	0.75
443	0.71
444	0.68
445	0.64
446	0.62
447	0.6
448	0.61
449	0.58
450	0.56
451	0.53
452	0.48
453	0.42
454	0.32

A0A427Y0P5

3D AlphaFold-predicted Structure Viewer