Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427XP41

Protein Details
Accession A0A427XP41   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-24RDTKERSKSRIDTKPYGKRPVSBasic
NLS Segment(s)
PositionSequence
72-89KGKSKSPSKSPSKDTKPK
152-159EKGVKGRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPRDTKERSKSRIDTKPYGKRPVSPPITPTKAVLDIGSYRQDPGSPLSSAPGEIKPDINSAGPTFDAASNGKGKSKSPSKSPSKDTKPKTPTSKNPSRPWSADELELLLNLVLETPPGIKTFEGRVPGRTGYQAVQTWRNTVVPYLHKALREKGVKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.82
4 0.8
5 0.81
6 0.74
7 0.71
8 0.69
9 0.69
10 0.66
11 0.58
12 0.54
13 0.54
14 0.57
15 0.51
16 0.47
17 0.4
18 0.35
19 0.33
20 0.28
21 0.22
22 0.18
23 0.2
24 0.22
25 0.18
26 0.17
27 0.16
28 0.17
29 0.15
30 0.17
31 0.17
32 0.15
33 0.14
34 0.15
35 0.15
36 0.16
37 0.17
38 0.15
39 0.14
40 0.14
41 0.15
42 0.14
43 0.15
44 0.15
45 0.14
46 0.13
47 0.11
48 0.11
49 0.1
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.1
56 0.12
57 0.13
58 0.15
59 0.15
60 0.16
61 0.21
62 0.28
63 0.28
64 0.32
65 0.41
66 0.47
67 0.52
68 0.58
69 0.61
70 0.63
71 0.69
72 0.68
73 0.69
74 0.66
75 0.68
76 0.71
77 0.7
78 0.7
79 0.7
80 0.75
81 0.74
82 0.76
83 0.74
84 0.7
85 0.63
86 0.57
87 0.54
88 0.45
89 0.37
90 0.3
91 0.25
92 0.2
93 0.18
94 0.15
95 0.08
96 0.06
97 0.05
98 0.05
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.06
105 0.08
106 0.07
107 0.1
108 0.14
109 0.17
110 0.23
111 0.24
112 0.26
113 0.28
114 0.3
115 0.29
116 0.27
117 0.25
118 0.2
119 0.24
120 0.25
121 0.26
122 0.32
123 0.31
124 0.32
125 0.32
126 0.32
127 0.27
128 0.26
129 0.28
130 0.26
131 0.3
132 0.34
133 0.35
134 0.38
135 0.41
136 0.44
137 0.47
138 0.47
139 0.46