Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y6R2

Protein Details
Accession A0A427Y6R2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
262-284LPSPDWGRRNRSQSPDRNRRETWHydrophilic
NLS Segment(s)
PositionSequence
249-250RG
253-265GSRGNGGGRLPSP
267-273WGRRNRS
Subcellular Location(s) extr 10, cyto 6.5, cyto_nucl 6.5, nucl 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MSSRSRTFSPRPSPDPEAEACPFLIRVFVTKNKQTPMIDFDDGKLPVQDEFQVYGWKHSTPTSIIQQLYSVFPAPYRSPLARYAFKHVYVDASERGLYRGKDLVTFTGRDFAATVSPQDQNGNGDGDVAMDRELDEAAAPRRGRVVEEKTLDSYGFLTGDLLSVAIHIPEPRAPAATSIRGASAREREGRDRDRDRDRDGFRDARNGAPSSRDGPWARGAPLPPQAFGGDRDRDDHRAPAGSWRGGAPRGAVGSRGNGGGRLPSPDWGRRNRSQSPDRNRRETWASRRERD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.56
4 0.52
5 0.45
6 0.4
7 0.33
8 0.28
9 0.25
10 0.19
11 0.18
12 0.12
13 0.13
14 0.18
15 0.25
16 0.32
17 0.39
18 0.44
19 0.45
20 0.51
21 0.49
22 0.47
23 0.45
24 0.44
25 0.4
26 0.36
27 0.34
28 0.34
29 0.33
30 0.3
31 0.25
32 0.19
33 0.16
34 0.17
35 0.17
36 0.13
37 0.15
38 0.15
39 0.2
40 0.2
41 0.23
42 0.23
43 0.22
44 0.21
45 0.2
46 0.22
47 0.19
48 0.24
49 0.26
50 0.3
51 0.29
52 0.28
53 0.28
54 0.27
55 0.25
56 0.21
57 0.17
58 0.11
59 0.11
60 0.15
61 0.15
62 0.17
63 0.2
64 0.2
65 0.22
66 0.28
67 0.34
68 0.37
69 0.38
70 0.43
71 0.42
72 0.42
73 0.4
74 0.34
75 0.3
76 0.25
77 0.26
78 0.18
79 0.16
80 0.16
81 0.15
82 0.16
83 0.17
84 0.16
85 0.15
86 0.17
87 0.16
88 0.17
89 0.18
90 0.2
91 0.19
92 0.2
93 0.18
94 0.2
95 0.19
96 0.17
97 0.16
98 0.13
99 0.13
100 0.12
101 0.12
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.11
108 0.12
109 0.12
110 0.09
111 0.09
112 0.08
113 0.08
114 0.08
115 0.07
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.11
126 0.11
127 0.11
128 0.12
129 0.13
130 0.14
131 0.18
132 0.22
133 0.24
134 0.26
135 0.27
136 0.27
137 0.27
138 0.26
139 0.2
140 0.15
141 0.1
142 0.07
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.03
150 0.03
151 0.04
152 0.03
153 0.04
154 0.04
155 0.05
156 0.06
157 0.08
158 0.08
159 0.09
160 0.09
161 0.12
162 0.14
163 0.16
164 0.15
165 0.14
166 0.15
167 0.15
168 0.15
169 0.16
170 0.17
171 0.19
172 0.23
173 0.25
174 0.29
175 0.36
176 0.41
177 0.47
178 0.49
179 0.53
180 0.57
181 0.59
182 0.6
183 0.61
184 0.58
185 0.54
186 0.53
187 0.53
188 0.45
189 0.48
190 0.43
191 0.38
192 0.39
193 0.36
194 0.31
195 0.27
196 0.28
197 0.24
198 0.24
199 0.27
200 0.24
201 0.25
202 0.3
203 0.3
204 0.3
205 0.29
206 0.29
207 0.27
208 0.34
209 0.32
210 0.27
211 0.26
212 0.25
213 0.23
214 0.25
215 0.27
216 0.23
217 0.23
218 0.26
219 0.28
220 0.32
221 0.32
222 0.32
223 0.28
224 0.27
225 0.27
226 0.32
227 0.34
228 0.3
229 0.29
230 0.28
231 0.29
232 0.27
233 0.28
234 0.2
235 0.17
236 0.19
237 0.18
238 0.18
239 0.16
240 0.18
241 0.18
242 0.19
243 0.17
244 0.15
245 0.15
246 0.17
247 0.17
248 0.2
249 0.19
250 0.23
251 0.29
252 0.36
253 0.43
254 0.48
255 0.55
256 0.58
257 0.65
258 0.68
259 0.72
260 0.75
261 0.78
262 0.81
263 0.84
264 0.84
265 0.84
266 0.78
267 0.74
268 0.73
269 0.73
270 0.72
271 0.72