Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427YAF2

Protein Details
Accession A0A427YAF2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
98-131MATKVDKAGRKLRKERKNRSKKLRGTSKAKAGDABasic
NLS Segment(s)
PositionSequence
100-134TKVDKAGRKLRKERKNRSKKLRGTSKAKAGDAKKK
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPNGPVTIRTSKFITNRLLNRKQFVLNISHPTRANLSRSELGERLAQLYKTEAQRVVVFGLRAKFGGGSSQGFGLIYDDEESQKKFEPKYRLIRSGMATKVDKAGRKLRKERKNRSKKLRGTSKAKAGDAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.46
4 0.53
5 0.6
6 0.66
7 0.64
8 0.64
9 0.62
10 0.56
11 0.5
12 0.44
13 0.41
14 0.36
15 0.41
16 0.39
17 0.4
18 0.38
19 0.36
20 0.38
21 0.34
22 0.33
23 0.26
24 0.29
25 0.29
26 0.3
27 0.32
28 0.28
29 0.26
30 0.25
31 0.23
32 0.2
33 0.18
34 0.17
35 0.13
36 0.15
37 0.18
38 0.18
39 0.2
40 0.17
41 0.17
42 0.17
43 0.18
44 0.17
45 0.14
46 0.12
47 0.12
48 0.13
49 0.11
50 0.11
51 0.1
52 0.09
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.1
71 0.14
72 0.16
73 0.18
74 0.25
75 0.31
76 0.38
77 0.48
78 0.54
79 0.57
80 0.56
81 0.57
82 0.54
83 0.53
84 0.47
85 0.42
86 0.36
87 0.31
88 0.34
89 0.34
90 0.34
91 0.33
92 0.4
93 0.44
94 0.52
95 0.62
96 0.67
97 0.73
98 0.81
99 0.87
100 0.89
101 0.91
102 0.93
103 0.93
104 0.94
105 0.93
106 0.93
107 0.92
108 0.9
109 0.88
110 0.86
111 0.85
112 0.81
113 0.75
114 0.72