Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y4X7

Protein Details
Accession A0A427Y4X7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-81SKDPSKTKPRDPKSKNHKVTGBasic
NLS Segment(s)
PositionSequence
69-73PRDPK
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MLALTLRTAARPALVLPRVVAARAVHMESHAKANPETEGPLYKAGNPSTIHPPSAETGQASKDPSKTKPRDPKSKNHKVTGGKNFGDLQQMHQVGSDSLQPWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.22
5 0.21
6 0.2
7 0.21
8 0.13
9 0.14
10 0.16
11 0.16
12 0.13
13 0.14
14 0.17
15 0.15
16 0.2
17 0.18
18 0.18
19 0.17
20 0.18
21 0.18
22 0.16
23 0.16
24 0.13
25 0.13
26 0.13
27 0.15
28 0.15
29 0.15
30 0.18
31 0.17
32 0.19
33 0.18
34 0.19
35 0.24
36 0.24
37 0.23
38 0.2
39 0.21
40 0.18
41 0.19
42 0.16
43 0.09
44 0.1
45 0.11
46 0.12
47 0.13
48 0.14
49 0.17
50 0.2
51 0.25
52 0.35
53 0.38
54 0.47
55 0.56
56 0.63
57 0.7
58 0.72
59 0.77
60 0.78
61 0.84
62 0.81
63 0.76
64 0.75
65 0.73
66 0.77
67 0.76
68 0.74
69 0.63
70 0.58
71 0.53
72 0.46
73 0.45
74 0.35
75 0.3
76 0.3
77 0.3
78 0.27
79 0.27
80 0.27
81 0.2
82 0.21
83 0.21