Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427XS28

Protein Details
Accession A0A427XS28    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
216-244DAAQSKAAARREKRKRAKARKAEAARAAVHydrophilic
NLS Segment(s)
PositionSequence
221-241KAAARREKRKRAKARKAEAAR
Subcellular Location(s) cyto 18, nucl 5, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MAALPVAESLTLSATLFHADVDSWLPASFGVSRPDADKAKDWEAALRQTARDRLGLGHPDLTDPLARARAATQRAGIETLRKLKGREKKGDDSDLAPTPGPGSSSRTAGRGGRDDSDDDESRTRSVSKKKTKTKDAFASKGKNAVHPLLNLRNPIPGYVPPVGGQQAQAEAVPKAPATTATVPALVVTGIKRAREDDEDADGDGDDKAEGDEGGDDAAQSKAAARREKRKRAKARKAEAARAAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.08
6 0.07
7 0.09
8 0.1
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.1
15 0.11
16 0.12
17 0.15
18 0.16
19 0.17
20 0.18
21 0.24
22 0.25
23 0.26
24 0.3
25 0.31
26 0.34
27 0.36
28 0.35
29 0.34
30 0.35
31 0.36
32 0.34
33 0.31
34 0.29
35 0.3
36 0.34
37 0.3
38 0.27
39 0.25
40 0.23
41 0.27
42 0.28
43 0.26
44 0.25
45 0.23
46 0.23
47 0.22
48 0.2
49 0.16
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.14
56 0.19
57 0.21
58 0.22
59 0.22
60 0.21
61 0.22
62 0.23
63 0.21
64 0.19
65 0.2
66 0.25
67 0.27
68 0.28
69 0.29
70 0.35
71 0.43
72 0.48
73 0.53
74 0.54
75 0.59
76 0.62
77 0.65
78 0.58
79 0.51
80 0.46
81 0.38
82 0.32
83 0.23
84 0.18
85 0.14
86 0.13
87 0.12
88 0.09
89 0.12
90 0.13
91 0.16
92 0.17
93 0.17
94 0.19
95 0.2
96 0.21
97 0.2
98 0.2
99 0.19
100 0.19
101 0.19
102 0.19
103 0.22
104 0.2
105 0.18
106 0.17
107 0.17
108 0.16
109 0.15
110 0.15
111 0.15
112 0.23
113 0.32
114 0.41
115 0.5
116 0.59
117 0.67
118 0.76
119 0.77
120 0.77
121 0.77
122 0.74
123 0.71
124 0.68
125 0.65
126 0.56
127 0.55
128 0.47
129 0.4
130 0.35
131 0.32
132 0.27
133 0.23
134 0.27
135 0.27
136 0.28
137 0.27
138 0.25
139 0.25
140 0.23
141 0.22
142 0.2
143 0.15
144 0.18
145 0.17
146 0.18
147 0.15
148 0.16
149 0.17
150 0.15
151 0.15
152 0.1
153 0.1
154 0.09
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.08
164 0.11
165 0.14
166 0.15
167 0.16
168 0.16
169 0.16
170 0.15
171 0.15
172 0.1
173 0.08
174 0.06
175 0.11
176 0.13
177 0.14
178 0.15
179 0.16
180 0.2
181 0.23
182 0.27
183 0.24
184 0.27
185 0.27
186 0.27
187 0.25
188 0.21
189 0.18
190 0.14
191 0.11
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.06
201 0.06
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.09
208 0.14
209 0.21
210 0.3
211 0.36
212 0.47
213 0.58
214 0.69
215 0.77
216 0.83
217 0.88
218 0.91
219 0.94
220 0.95
221 0.94
222 0.94
223 0.91
224 0.9
225 0.85