Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y6G1

Protein Details
Accession A0A427Y6G1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
337-363AAPKRGKAKAKGKSTPKPKPKAPPFIFHydrophilic
NLS Segment(s)
PositionSequence
337-358AAPKRGKAKAKGKSTPKPKPKA
Subcellular Location(s) cyto 13.5, cyto_mito 9.5, nucl 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015637  MUG/TDG  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0000700  F:mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF03167  UDG  
CDD cd10028  UDG-F2_TDG_MUG  
Amino Acid Sequences MAGASSIAAQLAQYAYSPAKVKSEPSPARGAQRGVPESGPSTSARRLQNALASARASTGDVDVKMEPLEDEETPDPPPARRSARNSQQKRLRDSDASDFAPSDSDTPTRQSPYFSRTGEVRMDDDPETPSTPTRSRRRRDDGSLEDFGWKKPRRFASPSRYAHLPALSDALRPGLDIVFVGINPGTRSSKTGHFFAHPTNKFWKALHGGGLTPRLLTPEEDVTLPDEYNYGMTNLVSRTTAEQAELSGHEKRVAVAPLATKMALNRPRVVCFVGKMIWDVFAGVAKRSIPKVSAKNEPSPSPQLARVVEYTLDSGGAVSREQDEDALVKIEPGEAPAAPKRGKAKAKGKSTPKPKPKAPPFIFDAPQPLRLAVSGPEGYVYFWVVPNTSGLERTKLEQQVVYFDALRAFVETLKAGQVPEGEFVDVTAEGIERVVEAIREKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.17
5 0.17
6 0.22
7 0.23
8 0.27
9 0.32
10 0.42
11 0.44
12 0.46
13 0.52
14 0.5
15 0.56
16 0.58
17 0.53
18 0.47
19 0.5
20 0.48
21 0.43
22 0.41
23 0.35
24 0.33
25 0.31
26 0.29
27 0.22
28 0.23
29 0.26
30 0.32
31 0.33
32 0.35
33 0.36
34 0.37
35 0.4
36 0.41
37 0.38
38 0.34
39 0.3
40 0.27
41 0.24
42 0.22
43 0.17
44 0.13
45 0.13
46 0.14
47 0.13
48 0.16
49 0.15
50 0.15
51 0.15
52 0.14
53 0.12
54 0.11
55 0.13
56 0.11
57 0.15
58 0.15
59 0.17
60 0.18
61 0.21
62 0.2
63 0.19
64 0.23
65 0.25
66 0.32
67 0.38
68 0.45
69 0.52
70 0.61
71 0.71
72 0.75
73 0.78
74 0.8
75 0.79
76 0.79
77 0.74
78 0.7
79 0.63
80 0.6
81 0.58
82 0.54
83 0.48
84 0.41
85 0.36
86 0.3
87 0.26
88 0.22
89 0.15
90 0.12
91 0.12
92 0.13
93 0.16
94 0.19
95 0.22
96 0.22
97 0.25
98 0.27
99 0.31
100 0.36
101 0.34
102 0.33
103 0.3
104 0.34
105 0.33
106 0.31
107 0.28
108 0.22
109 0.24
110 0.22
111 0.22
112 0.2
113 0.18
114 0.18
115 0.16
116 0.17
117 0.18
118 0.23
119 0.31
120 0.4
121 0.48
122 0.54
123 0.63
124 0.71
125 0.73
126 0.76
127 0.76
128 0.73
129 0.7
130 0.65
131 0.55
132 0.51
133 0.44
134 0.38
135 0.38
136 0.35
137 0.31
138 0.36
139 0.41
140 0.45
141 0.52
142 0.6
143 0.6
144 0.66
145 0.67
146 0.63
147 0.59
148 0.53
149 0.48
150 0.39
151 0.3
152 0.2
153 0.19
154 0.16
155 0.14
156 0.12
157 0.11
158 0.1
159 0.09
160 0.09
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.08
172 0.09
173 0.09
174 0.11
175 0.13
176 0.2
177 0.22
178 0.24
179 0.24
180 0.24
181 0.26
182 0.3
183 0.37
184 0.32
185 0.32
186 0.35
187 0.36
188 0.35
189 0.34
190 0.33
191 0.26
192 0.26
193 0.27
194 0.22
195 0.2
196 0.21
197 0.22
198 0.18
199 0.14
200 0.13
201 0.1
202 0.1
203 0.1
204 0.1
205 0.09
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.1
212 0.08
213 0.07
214 0.06
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.07
223 0.07
224 0.07
225 0.08
226 0.1
227 0.1
228 0.09
229 0.09
230 0.09
231 0.09
232 0.1
233 0.11
234 0.11
235 0.11
236 0.12
237 0.12
238 0.12
239 0.14
240 0.14
241 0.12
242 0.12
243 0.13
244 0.13
245 0.13
246 0.13
247 0.1
248 0.1
249 0.18
250 0.22
251 0.23
252 0.28
253 0.29
254 0.3
255 0.32
256 0.33
257 0.26
258 0.21
259 0.21
260 0.18
261 0.16
262 0.15
263 0.14
264 0.13
265 0.11
266 0.1
267 0.08
268 0.09
269 0.09
270 0.08
271 0.09
272 0.09
273 0.11
274 0.12
275 0.13
276 0.14
277 0.2
278 0.27
279 0.3
280 0.39
281 0.41
282 0.48
283 0.5
284 0.5
285 0.49
286 0.46
287 0.44
288 0.38
289 0.35
290 0.32
291 0.3
292 0.29
293 0.25
294 0.21
295 0.19
296 0.17
297 0.16
298 0.11
299 0.1
300 0.08
301 0.07
302 0.06
303 0.07
304 0.06
305 0.06
306 0.07
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.09
313 0.1
314 0.08
315 0.08
316 0.08
317 0.08
318 0.08
319 0.08
320 0.08
321 0.07
322 0.11
323 0.15
324 0.2
325 0.2
326 0.24
327 0.29
328 0.36
329 0.43
330 0.49
331 0.56
332 0.59
333 0.68
334 0.74
335 0.78
336 0.79
337 0.83
338 0.84
339 0.85
340 0.84
341 0.82
342 0.84
343 0.85
344 0.86
345 0.79
346 0.75
347 0.71
348 0.69
349 0.63
350 0.53
351 0.52
352 0.43
353 0.43
354 0.37
355 0.31
356 0.24
357 0.23
358 0.23
359 0.15
360 0.18
361 0.15
362 0.14
363 0.15
364 0.14
365 0.15
366 0.14
367 0.14
368 0.09
369 0.1
370 0.11
371 0.11
372 0.11
373 0.12
374 0.15
375 0.14
376 0.17
377 0.17
378 0.21
379 0.22
380 0.24
381 0.31
382 0.31
383 0.32
384 0.31
385 0.3
386 0.31
387 0.32
388 0.31
389 0.24
390 0.21
391 0.2
392 0.18
393 0.17
394 0.14
395 0.13
396 0.11
397 0.12
398 0.12
399 0.12
400 0.14
401 0.15
402 0.13
403 0.14
404 0.16
405 0.16
406 0.18
407 0.18
408 0.16
409 0.15
410 0.15
411 0.15
412 0.12
413 0.11
414 0.09
415 0.07
416 0.07
417 0.07
418 0.07
419 0.05
420 0.06
421 0.07
422 0.08
423 0.09