Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427XCW8

Protein Details
Accession A0A427XCW8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
215-236GLFAAKIRRWRKPEPYRGKGIFHydrophilic
NLS Segment(s)
PositionSequence
220-233KIRRWRKPEPYRGK
245-250REIKKK
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR000702  Ribosomal_L6  
IPR020040  Ribosomal_L6_a/b-dom  
IPR036789  Ribosomal_L6_a/b-dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00347  Ribosomal_L6  
Amino Acid Sequences MSSSRAAFQPLRRAFHSSARAQSHIGSLPVPIPAGVTLSYPPMSIDPTVPRTSPIARRLVEVKGPLGSQVISIEPPVILTPPAEQGGALVVSVHDAEQKSHASVWGLTRSLIHNAVVGVTTGYSVELKLVGVGYRAAVEPIPQVFRDIQAKIPRAVRPVKAGAPPYVLPPHPTERLNIKLGYSHPVLLDIPDGIKVAVPQPTKIVLTGNDKQKLGLFAAKIRRWRKPEPYRGKGIFIGDETIKLREIKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.57
4 0.52
5 0.54
6 0.54
7 0.53
8 0.47
9 0.45
10 0.4
11 0.34
12 0.29
13 0.21
14 0.17
15 0.16
16 0.16
17 0.15
18 0.1
19 0.09
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.12
27 0.11
28 0.12
29 0.11
30 0.13
31 0.13
32 0.15
33 0.18
34 0.23
35 0.25
36 0.24
37 0.25
38 0.26
39 0.31
40 0.35
41 0.36
42 0.38
43 0.37
44 0.39
45 0.41
46 0.4
47 0.38
48 0.33
49 0.28
50 0.22
51 0.21
52 0.19
53 0.17
54 0.14
55 0.1
56 0.1
57 0.09
58 0.08
59 0.08
60 0.08
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.07
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.06
82 0.06
83 0.07
84 0.09
85 0.1
86 0.1
87 0.11
88 0.11
89 0.1
90 0.11
91 0.13
92 0.13
93 0.13
94 0.12
95 0.13
96 0.14
97 0.15
98 0.14
99 0.12
100 0.1
101 0.09
102 0.09
103 0.08
104 0.07
105 0.05
106 0.04
107 0.04
108 0.03
109 0.04
110 0.04
111 0.03
112 0.03
113 0.04
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.07
128 0.08
129 0.08
130 0.09
131 0.09
132 0.12
133 0.14
134 0.14
135 0.18
136 0.24
137 0.26
138 0.27
139 0.31
140 0.31
141 0.33
142 0.36
143 0.33
144 0.31
145 0.32
146 0.33
147 0.33
148 0.33
149 0.29
150 0.28
151 0.27
152 0.26
153 0.26
154 0.23
155 0.21
156 0.23
157 0.26
158 0.27
159 0.27
160 0.26
161 0.29
162 0.33
163 0.34
164 0.31
165 0.26
166 0.26
167 0.26
168 0.28
169 0.23
170 0.2
171 0.17
172 0.17
173 0.17
174 0.14
175 0.14
176 0.1
177 0.09
178 0.08
179 0.09
180 0.07
181 0.07
182 0.07
183 0.09
184 0.15
185 0.15
186 0.15
187 0.17
188 0.2
189 0.2
190 0.2
191 0.2
192 0.18
193 0.25
194 0.31
195 0.38
196 0.4
197 0.4
198 0.4
199 0.4
200 0.38
201 0.32
202 0.3
203 0.23
204 0.26
205 0.35
206 0.39
207 0.46
208 0.5
209 0.57
210 0.59
211 0.67
212 0.71
213 0.72
214 0.79
215 0.81
216 0.83
217 0.84
218 0.8
219 0.75
220 0.67
221 0.6
222 0.51
223 0.41
224 0.38
225 0.28
226 0.29
227 0.26
228 0.24
229 0.23
230 0.23