Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IY07

Protein Details
Accession A0A3N4IY07    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-129NDKVYRYSKKYTWRSKKKMSKHydrophilic
NLS Segment(s)
PositionSequence
124-128KKKMS
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MVGYLHKVLQVLRQKPPGQQQFDKIMIQYYIVGLTSQRLRDIAILTYLKTNSHESSQQVIKGIRQFATQLKIKGGKKASRSSNCHNSDSKSGEDSSSDNNSDSNSDSDNDKVYRYSKKYTWRSKKKMSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.62
4 0.63
5 0.62
6 0.61
7 0.59
8 0.58
9 0.59
10 0.54
11 0.44
12 0.37
13 0.29
14 0.25
15 0.2
16 0.13
17 0.1
18 0.09
19 0.09
20 0.06
21 0.09
22 0.12
23 0.12
24 0.12
25 0.12
26 0.12
27 0.14
28 0.15
29 0.13
30 0.14
31 0.14
32 0.14
33 0.16
34 0.16
35 0.15
36 0.15
37 0.18
38 0.14
39 0.16
40 0.18
41 0.18
42 0.22
43 0.23
44 0.21
45 0.21
46 0.2
47 0.2
48 0.21
49 0.2
50 0.17
51 0.15
52 0.16
53 0.16
54 0.21
55 0.21
56 0.19
57 0.2
58 0.27
59 0.28
60 0.32
61 0.36
62 0.36
63 0.39
64 0.45
65 0.52
66 0.53
67 0.59
68 0.61
69 0.65
70 0.64
71 0.63
72 0.58
73 0.52
74 0.49
75 0.45
76 0.39
77 0.31
78 0.27
79 0.24
80 0.22
81 0.21
82 0.2
83 0.2
84 0.19
85 0.17
86 0.17
87 0.17
88 0.17
89 0.18
90 0.15
91 0.13
92 0.13
93 0.15
94 0.16
95 0.19
96 0.19
97 0.18
98 0.19
99 0.22
100 0.3
101 0.34
102 0.4
103 0.42
104 0.52
105 0.61
106 0.7
107 0.77
108 0.79
109 0.84