Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JZY6

Protein Details
Accession A0A3N4JZY6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
187-220LEEERRSDERKLRKEKERRSDERKLRKEKELENABasic
NLS Segment(s)
PositionSequence
184-215ERKLEEERRSDERKLRKEKERRSDERKLRKEK
Subcellular Location(s) cyto_nucl 9.666, nucl 9.5, cyto_mito 9.333, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR040260  RFA2-like  
IPR018856  Stn1_N  
Pfam View protein in Pfam  
PF10451  Stn1  
CDD cd03524  RPA2_OBF_family  
Amino Acid Sequences MTATPPAESLSFYPRFLFSHSPTYNQWARLTAKDIHEGLHQRRGFEGQDVWFYTNHPIRWVRIVGIVVAYDDMEKMVCITVDDGSGYLMDLIAWKGKPPEGKKPKFSFDGLKNVSLHSIIKAKGSVGEFRGNKQLLLRRIEVLHDTNSEVDAWAETIKFKKNVLSKPWYLTEERRAAEAKAEEERKLEEERRSDERKLRKEKERRSDERKLRKEKELENAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.27
4 0.32
5 0.28
6 0.36
7 0.37
8 0.39
9 0.4
10 0.46
11 0.46
12 0.43
13 0.4
14 0.35
15 0.37
16 0.36
17 0.38
18 0.36
19 0.35
20 0.37
21 0.36
22 0.32
23 0.34
24 0.39
25 0.38
26 0.41
27 0.39
28 0.34
29 0.35
30 0.37
31 0.32
32 0.27
33 0.27
34 0.2
35 0.23
36 0.24
37 0.24
38 0.21
39 0.21
40 0.25
41 0.26
42 0.25
43 0.26
44 0.26
45 0.27
46 0.31
47 0.31
48 0.25
49 0.23
50 0.23
51 0.18
52 0.17
53 0.15
54 0.1
55 0.09
56 0.08
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.06
80 0.06
81 0.07
82 0.08
83 0.1
84 0.16
85 0.19
86 0.3
87 0.39
88 0.44
89 0.52
90 0.56
91 0.58
92 0.55
93 0.54
94 0.5
95 0.43
96 0.48
97 0.41
98 0.39
99 0.35
100 0.32
101 0.3
102 0.24
103 0.2
104 0.11
105 0.13
106 0.11
107 0.11
108 0.11
109 0.11
110 0.13
111 0.14
112 0.15
113 0.14
114 0.21
115 0.2
116 0.22
117 0.29
118 0.26
119 0.25
120 0.26
121 0.3
122 0.28
123 0.32
124 0.31
125 0.27
126 0.27
127 0.28
128 0.27
129 0.23
130 0.2
131 0.17
132 0.16
133 0.15
134 0.15
135 0.13
136 0.1
137 0.08
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.1
144 0.14
145 0.15
146 0.16
147 0.21
148 0.28
149 0.35
150 0.42
151 0.47
152 0.46
153 0.49
154 0.53
155 0.5
156 0.46
157 0.44
158 0.45
159 0.44
160 0.41
161 0.39
162 0.36
163 0.33
164 0.35
165 0.32
166 0.26
167 0.28
168 0.3
169 0.28
170 0.28
171 0.3
172 0.27
173 0.31
174 0.33
175 0.31
176 0.35
177 0.39
178 0.46
179 0.49
180 0.53
181 0.56
182 0.61
183 0.65
184 0.7
185 0.74
186 0.76
187 0.82
188 0.86
189 0.89
190 0.89
191 0.89
192 0.87
193 0.89
194 0.89
195 0.9
196 0.89
197 0.89
198 0.85
199 0.85
200 0.84
201 0.8