Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JWG4

Protein Details
Accession A0A3N4JWG4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-51NSTIVRTRIPKRHHRREIPQSRRKKRKKKNHVLAVELRCBasic
NLS Segment(s)
PositionSequence
20-41RIPKRHHRREIPQSRRKKRKKK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
Amino Acid Sequences MITPIHYRIAPINSTIVRTRIPKRHHRREIPQSRRKKRKKKNHVLAVELRCTHRYVPDTGGWAHYSSLECLPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.24
5 0.28
6 0.35
7 0.38
8 0.45
9 0.53
10 0.62
11 0.71
12 0.78
13 0.81
14 0.83
15 0.86
16 0.9
17 0.89
18 0.88
19 0.88
20 0.88
21 0.9
22 0.91
23 0.91
24 0.9
25 0.91
26 0.93
27 0.93
28 0.94
29 0.93
30 0.87
31 0.83
32 0.81
33 0.74
34 0.67
35 0.57
36 0.48
37 0.39
38 0.36
39 0.3
40 0.26
41 0.24
42 0.23
43 0.25
44 0.26
45 0.27
46 0.27
47 0.29
48 0.25
49 0.23
50 0.21
51 0.19
52 0.18
53 0.17