Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JWK3

Protein Details
Accession A0A3N4JWK3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40IEPNPPGTNVKPRKKPKQRIQSTTKSPQHHydrophilic
NLS Segment(s)
PositionSequence
22-28KPRKKPK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHYSNLQKGQEIEPNPPGTNVKPRKKPKQRIQSTTKSPQHHYSTSIDPIIGGDASVGNSGHERCSVEVKLHITHQNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.32
5 0.28
6 0.37
7 0.42
8 0.46
9 0.53
10 0.62
11 0.72
12 0.8
13 0.88
14 0.88
15 0.89
16 0.9
17 0.89
18 0.88
19 0.86
20 0.83
21 0.82
22 0.78
23 0.71
24 0.64
25 0.62
26 0.58
27 0.5
28 0.45
29 0.38
30 0.34
31 0.33
32 0.29
33 0.22
34 0.17
35 0.16
36 0.14
37 0.1
38 0.06
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.05
45 0.07
46 0.08
47 0.09
48 0.11
49 0.12
50 0.13
51 0.18
52 0.19
53 0.2
54 0.24
55 0.27
56 0.28
57 0.32