Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K2U4

Protein Details
Accession A0A3N4K2U4   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-67HDPWRNRQECHNTRRKRKKKREHQNVRSASLBasic
NLS Segment(s)
PositionSequence
50-58RRKRKKKRE
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MFDNIRKTLPTNNSQFTIRNFLEKGQRIQTNYQELIHDPWRNRQECHNTRRKRKKKREHQNVRSASLAPAHLTATILSNPRSAIHYQTQDLHSHHSLTHSHSAIPDYTRTKFLSAPPPRILKHHITPDQKIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.43
4 0.45
5 0.37
6 0.35
7 0.31
8 0.33
9 0.4
10 0.4
11 0.42
12 0.41
13 0.44
14 0.43
15 0.47
16 0.49
17 0.46
18 0.43
19 0.4
20 0.34
21 0.31
22 0.32
23 0.33
24 0.32
25 0.26
26 0.33
27 0.4
28 0.41
29 0.41
30 0.45
31 0.5
32 0.55
33 0.63
34 0.65
35 0.66
36 0.75
37 0.85
38 0.88
39 0.88
40 0.9
41 0.92
42 0.93
43 0.95
44 0.95
45 0.95
46 0.94
47 0.93
48 0.86
49 0.77
50 0.67
51 0.57
52 0.45
53 0.35
54 0.26
55 0.16
56 0.12
57 0.1
58 0.08
59 0.08
60 0.07
61 0.07
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.13
69 0.13
70 0.15
71 0.19
72 0.21
73 0.22
74 0.26
75 0.27
76 0.28
77 0.28
78 0.29
79 0.25
80 0.23
81 0.22
82 0.21
83 0.21
84 0.22
85 0.27
86 0.23
87 0.22
88 0.22
89 0.24
90 0.23
91 0.23
92 0.24
93 0.22
94 0.23
95 0.26
96 0.26
97 0.26
98 0.27
99 0.32
100 0.37
101 0.41
102 0.46
103 0.49
104 0.54
105 0.53
106 0.56
107 0.56
108 0.53
109 0.54
110 0.57
111 0.59
112 0.6
113 0.67