Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JLY5

Protein Details
Accession A0A3N4JLY5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-42GYTSLRILGKKRRIRKNKGKCKESESKPBasic
NLS Segment(s)
PositionSequence
23-35GKKRRIRKNKGKC
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MNLKPEFVPDLRVSGYTSLRILGKKRRIRKNKGKCKESESKPNRISYALSHRSGTERVYKDLYRLEKRKLFFEQLGIHQSIIAYRTNIPPFDTELPSPISGSVSSQGLTRVINNKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.19
4 0.19
5 0.18
6 0.19
7 0.22
8 0.26
9 0.32
10 0.41
11 0.48
12 0.58
13 0.67
14 0.74
15 0.82
16 0.87
17 0.89
18 0.9
19 0.92
20 0.9
21 0.83
22 0.81
23 0.8
24 0.76
25 0.76
26 0.7
27 0.7
28 0.66
29 0.64
30 0.57
31 0.48
32 0.42
33 0.35
34 0.4
35 0.35
36 0.32
37 0.3
38 0.29
39 0.3
40 0.3
41 0.27
42 0.25
43 0.21
44 0.21
45 0.24
46 0.24
47 0.23
48 0.28
49 0.33
50 0.33
51 0.35
52 0.4
53 0.41
54 0.42
55 0.45
56 0.44
57 0.41
58 0.34
59 0.35
60 0.32
61 0.3
62 0.33
63 0.29
64 0.25
65 0.21
66 0.2
67 0.16
68 0.14
69 0.11
70 0.09
71 0.11
72 0.16
73 0.19
74 0.19
75 0.2
76 0.2
77 0.24
78 0.27
79 0.28
80 0.23
81 0.23
82 0.26
83 0.25
84 0.24
85 0.19
86 0.16
87 0.13
88 0.14
89 0.14
90 0.12
91 0.12
92 0.12
93 0.13
94 0.13
95 0.14
96 0.17