Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IUT4

Protein Details
Accession A0A3N4IUT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26TTTVPQKTPKRPTRMHPFSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 7, golg 4, cyto_mito 4, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDEWLTTTVPQKTPKRPTRMHPFSPLWVRGLLVLQGGSPNQHPVSDFHDGFKVFILTLDDSLFSMFLSLLFFVWLLICPLDALRGLSTLTYQRHPFLGPHPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.71
4 0.72
5 0.77
6 0.79
7 0.8
8 0.76
9 0.74
10 0.68
11 0.66
12 0.67
13 0.59
14 0.49
15 0.4
16 0.34
17 0.26
18 0.24
19 0.17
20 0.1
21 0.09
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.1
31 0.11
32 0.16
33 0.21
34 0.21
35 0.19
36 0.21
37 0.21
38 0.2
39 0.19
40 0.14
41 0.08
42 0.08
43 0.09
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.1
76 0.15
77 0.18
78 0.22
79 0.23
80 0.25
81 0.26
82 0.28
83 0.29