Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JUM7

Protein Details
Accession A0A3N4JUM7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29FSTIRPTTPRRTSRKEEWKTPKRQALSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSFSTIRPTTPRRTSRKEEWKTPKRQALSYRLKNPHPRHVHHIENFWRIIKQRIRARPKFPETVEKKMRIAVQEEWNQLEPKDWRKFIDSLPERIKEVKQRGGLAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.83
4 0.81
5 0.82
6 0.84
7 0.85
8 0.86
9 0.87
10 0.84
11 0.76
12 0.75
13 0.71
14 0.71
15 0.72
16 0.71
17 0.71
18 0.69
19 0.72
20 0.76
21 0.74
22 0.73
23 0.7
24 0.65
25 0.63
26 0.63
27 0.64
28 0.57
29 0.59
30 0.54
31 0.49
32 0.46
33 0.39
34 0.34
35 0.27
36 0.32
37 0.29
38 0.32
39 0.36
40 0.45
41 0.54
42 0.58
43 0.64
44 0.66
45 0.67
46 0.65
47 0.59
48 0.6
49 0.55
50 0.59
51 0.59
52 0.53
53 0.48
54 0.45
55 0.45
56 0.37
57 0.35
58 0.31
59 0.32
60 0.35
61 0.36
62 0.35
63 0.35
64 0.34
65 0.3
66 0.29
67 0.26
68 0.29
69 0.35
70 0.34
71 0.35
72 0.38
73 0.41
74 0.39
75 0.46
76 0.42
77 0.43
78 0.48
79 0.48
80 0.46
81 0.47
82 0.49
83 0.48
84 0.51
85 0.5
86 0.49