Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K645

Protein Details
Accession A0A3N4K645    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23QGKRKKSSRKPTGPKKNEPLATAHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPTGPKK
Subcellular Location(s) mito 23, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences QGKRKKSSRKPTGPKKNEPLATAFSCLFCNHEKSVTCKLDKKAGVGSLACKVCGQRFQANINYLSAAIDVYSEWVDACD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.88
4 0.8
5 0.71
6 0.63
7 0.58
8 0.5
9 0.42
10 0.34
11 0.25
12 0.23
13 0.21
14 0.19
15 0.16
16 0.18
17 0.16
18 0.19
19 0.19
20 0.24
21 0.33
22 0.34
23 0.35
24 0.37
25 0.37
26 0.4
27 0.4
28 0.36
29 0.3
30 0.27
31 0.26
32 0.21
33 0.21
34 0.2
35 0.2
36 0.19
37 0.16
38 0.16
39 0.16
40 0.21
41 0.24
42 0.23
43 0.26
44 0.31
45 0.36
46 0.39
47 0.37
48 0.34
49 0.3
50 0.24
51 0.21
52 0.17
53 0.11
54 0.07
55 0.06
56 0.05
57 0.07
58 0.07
59 0.06