Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JI65

Protein Details
Accession A0A3N4JI65   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28EPRRSVRSTKGPKKKSTAKSRVTPPPQSHydrophilic
NLS Segment(s)
PositionSequence
6-19VRSTKGPKKKSTAK
Subcellular Location(s) nucl 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences EPRRSVRSTKGPKKKSTAKSRVTPPPQSESPKNESEEKDGSDDIIRCVCGATEEDEDDDRMMIQCEGCDAWQHTMCMGIAKKHIPKVYFCEVCSPELHKPLLAQIEKGEKPWEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.85
5 0.83
6 0.82
7 0.83
8 0.84
9 0.82
10 0.79
11 0.72
12 0.69
13 0.66
14 0.65
15 0.63
16 0.58
17 0.56
18 0.53
19 0.51
20 0.49
21 0.45
22 0.43
23 0.39
24 0.34
25 0.31
26 0.26
27 0.24
28 0.22
29 0.2
30 0.16
31 0.14
32 0.12
33 0.1
34 0.1
35 0.09
36 0.07
37 0.07
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.11
44 0.1
45 0.09
46 0.06
47 0.05
48 0.06
49 0.05
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.07
56 0.08
57 0.11
58 0.12
59 0.13
60 0.12
61 0.13
62 0.13
63 0.15
64 0.15
65 0.14
66 0.15
67 0.2
68 0.24
69 0.28
70 0.32
71 0.3
72 0.32
73 0.37
74 0.43
75 0.41
76 0.38
77 0.41
78 0.39
79 0.39
80 0.39
81 0.37
82 0.32
83 0.34
84 0.34
85 0.26
86 0.25
87 0.28
88 0.35
89 0.31
90 0.27
91 0.27
92 0.35
93 0.35
94 0.36
95 0.39