Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JAK5

Protein Details
Accession A0A3N4JAK5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-27MGGCKVLPRTGRKEKKKSGLSLNKPHydrophilic
NLS Segment(s)
PositionSequence
13-19GRKEKKK
Subcellular Location(s) mito 10.5, cyto_mito 7.333, cyto 3, plas 3, pero 3, E.R. 3, golg 3, cyto_nucl 2.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVMGGCKVLPRTGRKEKKKSGLSLNKPLVRSNHRNSSEPQPLRTSMASNRTEISESAVNLSRLMYYWIIICLFIYYEFGVLGCLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.75
3 0.8
4 0.84
5 0.85
6 0.82
7 0.82
8 0.82
9 0.79
10 0.79
11 0.78
12 0.72
13 0.65
14 0.61
15 0.56
16 0.54
17 0.54
18 0.5
19 0.52
20 0.51
21 0.52
22 0.52
23 0.55
24 0.56
25 0.5
26 0.45
27 0.38
28 0.36
29 0.36
30 0.33
31 0.27
32 0.2
33 0.27
34 0.26
35 0.24
36 0.24
37 0.22
38 0.23
39 0.21
40 0.21
41 0.15
42 0.13
43 0.15
44 0.18
45 0.17
46 0.16
47 0.16
48 0.12
49 0.11
50 0.13
51 0.11
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.08
59 0.08
60 0.08
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08