Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J8W4

Protein Details
Accession A0A3N4J8W4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
156-185IEKLEKAGKEKRLKEKKVNSSKKAFRKGGNBasic
NLS Segment(s)
PositionSequence
153-183KKRIEKLEKAGKEKRLKEKKVNSSKKAFRKG
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
PROSITE View protein in PROSITE  
PS00745  RF_PROK_I  
Amino Acid Sequences MFLIRRPTVFAWPTEVRITIALWRTYKTSSGEEEEQIKQKRKWLAEFIPESIPRKNCDVSFSRASGPGGQNVNKVNSKVTLRLNLSTKGDFIPPYILEEVLKKSKYMTNNDEIVIQSDSSRKQAENIENCYRKLYTSIRECIQVPGETSEDTKKRIEKLEKAGKEKRLKEKKVNSSKKAFRKGGNEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.26
4 0.24
5 0.24
6 0.22
7 0.24
8 0.26
9 0.25
10 0.25
11 0.27
12 0.28
13 0.3
14 0.28
15 0.27
16 0.26
17 0.31
18 0.32
19 0.33
20 0.35
21 0.36
22 0.4
23 0.43
24 0.46
25 0.42
26 0.45
27 0.5
28 0.5
29 0.52
30 0.52
31 0.51
32 0.53
33 0.55
34 0.51
35 0.5
36 0.48
37 0.45
38 0.42
39 0.38
40 0.31
41 0.32
42 0.32
43 0.27
44 0.3
45 0.31
46 0.32
47 0.33
48 0.33
49 0.31
50 0.29
51 0.3
52 0.29
53 0.26
54 0.24
55 0.24
56 0.23
57 0.24
58 0.24
59 0.28
60 0.24
61 0.24
62 0.2
63 0.2
64 0.2
65 0.22
66 0.22
67 0.24
68 0.25
69 0.28
70 0.29
71 0.28
72 0.29
73 0.25
74 0.23
75 0.18
76 0.18
77 0.14
78 0.12
79 0.11
80 0.09
81 0.11
82 0.11
83 0.1
84 0.09
85 0.1
86 0.13
87 0.15
88 0.16
89 0.13
90 0.15
91 0.19
92 0.23
93 0.29
94 0.3
95 0.31
96 0.33
97 0.33
98 0.32
99 0.29
100 0.26
101 0.2
102 0.15
103 0.11
104 0.12
105 0.12
106 0.14
107 0.15
108 0.13
109 0.15
110 0.22
111 0.29
112 0.33
113 0.39
114 0.46
115 0.47
116 0.48
117 0.48
118 0.41
119 0.33
120 0.32
121 0.3
122 0.28
123 0.33
124 0.37
125 0.36
126 0.38
127 0.39
128 0.37
129 0.35
130 0.28
131 0.23
132 0.21
133 0.21
134 0.19
135 0.2
136 0.25
137 0.24
138 0.25
139 0.28
140 0.29
141 0.32
142 0.41
143 0.47
144 0.47
145 0.56
146 0.64
147 0.67
148 0.72
149 0.75
150 0.75
151 0.77
152 0.77
153 0.78
154 0.78
155 0.79
156 0.82
157 0.85
158 0.86
159 0.88
160 0.9
161 0.87
162 0.87
163 0.88
164 0.88
165 0.88
166 0.83
167 0.79