Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IY29

Protein Details
Accession A0A3N4IY29    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-127SSLFKGEEKHSGKKRKKNSPSALTQLHydrophilic
NLS Segment(s)
PositionSequence
93-119RARRPEPPSSSLFKGEEKHSGKKRKKN
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MLTPPNHHPSLEKKPPPSQSFPDSIIPPTITPFLFSFPSKVKNDTPAYFRHNSHDNDQVTAAELSLSSTPPPPPPPPPQHIHYTVKTGIIGPRARRPEPPSSSLFKGEEKHSGKKRKKNSPSALTQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.73
4 0.71
5 0.66
6 0.61
7 0.59
8 0.56
9 0.52
10 0.45
11 0.39
12 0.35
13 0.3
14 0.24
15 0.22
16 0.2
17 0.16
18 0.16
19 0.15
20 0.15
21 0.17
22 0.17
23 0.18
24 0.19
25 0.26
26 0.25
27 0.29
28 0.28
29 0.33
30 0.38
31 0.37
32 0.37
33 0.35
34 0.39
35 0.39
36 0.38
37 0.35
38 0.36
39 0.36
40 0.36
41 0.39
42 0.33
43 0.3
44 0.3
45 0.26
46 0.21
47 0.18
48 0.15
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.1
58 0.13
59 0.15
60 0.21
61 0.29
62 0.35
63 0.39
64 0.42
65 0.43
66 0.46
67 0.5
68 0.5
69 0.43
70 0.42
71 0.37
72 0.34
73 0.31
74 0.27
75 0.22
76 0.23
77 0.26
78 0.24
79 0.31
80 0.36
81 0.38
82 0.42
83 0.46
84 0.49
85 0.51
86 0.52
87 0.5
88 0.49
89 0.51
90 0.49
91 0.46
92 0.4
93 0.38
94 0.36
95 0.41
96 0.4
97 0.47
98 0.52
99 0.61
100 0.66
101 0.73
102 0.8
103 0.81
104 0.87
105 0.88
106 0.89
107 0.88