Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J6U9

Protein Details
Accession A0A3N4J6U9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
126-171EEGDREKEKEKRRAEKKARRREERRGKEEGEKERKKVKKEKVEVEEBasic
NLS Segment(s)
PositionSequence
131-166EKEKEKRRAEKKARRREERRGKEEGEKERKKVKKEK
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTTTTPHPPTTLHGSTPLSPRSAESFLSAFLADASRKPNQNEIVLTNLLRVQQALAGVYVPPPELTAAEVIAAEAEVEQVLTKGEAGSGEIVSEGGKGEYGEVKVDEGGMGRRVEIEVVPKVVTTEEGDREKEKEKRRAEKKARRREERRGKEEGEKERKKVKKEKVEVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.42
4 0.39
5 0.32
6 0.29
7 0.3
8 0.3
9 0.29
10 0.25
11 0.22
12 0.2
13 0.19
14 0.2
15 0.18
16 0.12
17 0.11
18 0.12
19 0.09
20 0.11
21 0.14
22 0.18
23 0.22
24 0.24
25 0.3
26 0.32
27 0.35
28 0.35
29 0.33
30 0.32
31 0.3
32 0.28
33 0.22
34 0.2
35 0.17
36 0.15
37 0.13
38 0.09
39 0.08
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.07
46 0.07
47 0.06
48 0.05
49 0.05
50 0.06
51 0.05
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.04
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.07
96 0.09
97 0.09
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.12
104 0.1
105 0.12
106 0.12
107 0.11
108 0.12
109 0.11
110 0.12
111 0.1
112 0.12
113 0.16
114 0.19
115 0.21
116 0.22
117 0.25
118 0.31
119 0.37
120 0.42
121 0.47
122 0.54
123 0.63
124 0.7
125 0.79
126 0.83
127 0.87
128 0.88
129 0.9
130 0.92
131 0.92
132 0.91
133 0.91
134 0.92
135 0.92
136 0.87
137 0.83
138 0.78
139 0.76
140 0.76
141 0.76
142 0.76
143 0.71
144 0.71
145 0.73
146 0.75
147 0.74
148 0.76
149 0.76
150 0.76
151 0.79