Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K4Y3

Protein Details
Accession A0A3N4K4Y3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-48YSYSRGFLNCKKKKKKLFVNVFEDRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 4, extr 3, pero 3, plas 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKEGVLFGIVLRKYMLFGVILQDYSYSRGFLNCKKKKKKLFVNVFEDRVTAGSREARVLCFGLYCTVCLSSGATFLSFGDYSPPRAGEDLNLPVLPGEVQVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.08
4 0.08
5 0.11
6 0.12
7 0.12
8 0.11
9 0.11
10 0.11
11 0.13
12 0.13
13 0.11
14 0.1
15 0.13
16 0.17
17 0.24
18 0.35
19 0.41
20 0.51
21 0.6
22 0.7
23 0.77
24 0.83
25 0.86
26 0.85
27 0.87
28 0.86
29 0.84
30 0.79
31 0.72
32 0.61
33 0.51
34 0.4
35 0.29
36 0.21
37 0.12
38 0.09
39 0.09
40 0.09
41 0.11
42 0.11
43 0.1
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.1
64 0.09
65 0.09
66 0.14
67 0.14
68 0.18
69 0.19
70 0.2
71 0.18
72 0.19
73 0.19
74 0.16
75 0.21
76 0.21
77 0.22
78 0.21
79 0.2
80 0.19
81 0.19
82 0.16