Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K6I1

Protein Details
Accession A0A3N4K6I1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22CIVRNLTRTLRKKRICNVRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MGCIVRNLTRTLRKKRICNVRNITIANPSGGGFSFFLVVDLKCGWGGFECEEEAAMEGWEIRVDCGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.82
4 0.77
5 0.79
6 0.77
7 0.73
8 0.72
9 0.65
10 0.57
11 0.5
12 0.44
13 0.34
14 0.26
15 0.19
16 0.13
17 0.11
18 0.11
19 0.07
20 0.06
21 0.07
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.08
34 0.08
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07