Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IYD5

Protein Details
Accession A0A3N4IYD5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
78-107KASRKRTKTGCLTCRKRRIKCGEERPTCANHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MESQLPPGYSATSGSDETGTSDQQQQQQPQQSGSGNSPETTDATSSSSAVQNAAASPPDSGDGGNSKAAPSSASAVAKASRKRTKTGCLTCRKRRIKCGEERPTCANCIKSKRGCEGYNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.17
5 0.17
6 0.15
7 0.14
8 0.19
9 0.22
10 0.28
11 0.34
12 0.35
13 0.4
14 0.47
15 0.47
16 0.42
17 0.42
18 0.37
19 0.34
20 0.31
21 0.29
22 0.22
23 0.2
24 0.2
25 0.17
26 0.16
27 0.15
28 0.13
29 0.09
30 0.11
31 0.11
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.08
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.1
60 0.11
61 0.11
62 0.12
63 0.15
64 0.2
65 0.23
66 0.29
67 0.34
68 0.36
69 0.42
70 0.46
71 0.51
72 0.57
73 0.63
74 0.64
75 0.68
76 0.75
77 0.8
78 0.86
79 0.87
80 0.84
81 0.84
82 0.85
83 0.83
84 0.84
85 0.85
86 0.85
87 0.82
88 0.81
89 0.77
90 0.7
91 0.64
92 0.57
93 0.51
94 0.48
95 0.49
96 0.53
97 0.54
98 0.57
99 0.63
100 0.66