Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K2Y0

Protein Details
Accession A0A3N4K2Y0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78VSKNPIRQLIQQKRKKKFLTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, extr 5, mito 4, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MRLDSFCFCLTCFTLCFFEFPLYRGVSSKLIYLEGRYSRGCTTLSIRLFDCPFHSSTLVSKNPIRQLIQQKRKKKFLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.18
5 0.21
6 0.19
7 0.19
8 0.2
9 0.18
10 0.18
11 0.18
12 0.19
13 0.17
14 0.17
15 0.18
16 0.14
17 0.15
18 0.15
19 0.15
20 0.17
21 0.16
22 0.18
23 0.16
24 0.17
25 0.16
26 0.17
27 0.16
28 0.13
29 0.16
30 0.2
31 0.21
32 0.21
33 0.21
34 0.23
35 0.23
36 0.22
37 0.21
38 0.17
39 0.17
40 0.17
41 0.17
42 0.15
43 0.18
44 0.25
45 0.25
46 0.26
47 0.28
48 0.32
49 0.37
50 0.41
51 0.4
52 0.41
53 0.5
54 0.58
55 0.66
56 0.69
57 0.74
58 0.79