Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JX45

Protein Details
Accession A0A3N4JX45    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-45NPPGTSVKPRTKPKQRIQPTKKSPQHHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.833, cyto 5.5, cyto_pero 3.832
Family & Domain DBs
Amino Acid Sequences MPYKTHCNSLQKAQEVEPNPPGTSVKPRTKPKQRIQPTKKSPQHHHSTSIDPIMGGDASMGDSGHERCSVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.45
4 0.41
5 0.35
6 0.3
7 0.29
8 0.28
9 0.23
10 0.3
11 0.34
12 0.38
13 0.44
14 0.53
15 0.62
16 0.72
17 0.79
18 0.8
19 0.82
20 0.84
21 0.87
22 0.86
23 0.87
24 0.85
25 0.85
26 0.83
27 0.8
28 0.77
29 0.74
30 0.75
31 0.67
32 0.65
33 0.57
34 0.54
35 0.49
36 0.43
37 0.34
38 0.25
39 0.22
40 0.17
41 0.13
42 0.09
43 0.06
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.07
50 0.09
51 0.11
52 0.12