Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JSV0

Protein Details
Accession A0A3N4JSV0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
201-227EGWGIKARKTQRKATKRVEEEARRRNLHydrophilic
NLS Segment(s)
PositionSequence
199-224KGEGWGIKARKTQRKATKRVEEEARR
Subcellular Location(s) plas 12, extr 10, E.R. 3
Family & Domain DBs
Amino Acid Sequences MIAPAVLFLFLSISSISRWLGCISAVLCRRWCLCAVGGFYLPPTKPPNIPILPQRRLNLLLANQEPHPPASTTLLLNTHKPSLYKVLGRSFNPSHPRSTPKFLLGNTLRAHNPLRFIQHVPQPAVTFTLLGRQYSILSTVRSVVCVCGCLVLRRAFLIYACNAHMQQLKALEESGKWGEDGDEVTVDKNKPIPFGYKSKGEGWGIKARKTQRKATKRVEEEARRRNLGEEGGLKGVWISVGIGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.1
5 0.11
6 0.11
7 0.11
8 0.1
9 0.12
10 0.11
11 0.19
12 0.22
13 0.25
14 0.26
15 0.28
16 0.29
17 0.29
18 0.3
19 0.25
20 0.24
21 0.26
22 0.27
23 0.27
24 0.26
25 0.24
26 0.23
27 0.25
28 0.22
29 0.21
30 0.23
31 0.22
32 0.24
33 0.26
34 0.34
35 0.32
36 0.36
37 0.42
38 0.47
39 0.5
40 0.53
41 0.52
42 0.47
43 0.46
44 0.43
45 0.39
46 0.32
47 0.33
48 0.29
49 0.3
50 0.27
51 0.28
52 0.27
53 0.23
54 0.22
55 0.16
56 0.16
57 0.17
58 0.18
59 0.16
60 0.17
61 0.21
62 0.21
63 0.22
64 0.23
65 0.21
66 0.21
67 0.21
68 0.21
69 0.22
70 0.24
71 0.25
72 0.27
73 0.32
74 0.36
75 0.36
76 0.4
77 0.37
78 0.4
79 0.44
80 0.41
81 0.38
82 0.37
83 0.43
84 0.41
85 0.45
86 0.41
87 0.38
88 0.4
89 0.36
90 0.41
91 0.36
92 0.37
93 0.31
94 0.32
95 0.27
96 0.26
97 0.28
98 0.2
99 0.21
100 0.17
101 0.2
102 0.19
103 0.21
104 0.23
105 0.26
106 0.28
107 0.26
108 0.25
109 0.23
110 0.2
111 0.2
112 0.16
113 0.11
114 0.08
115 0.13
116 0.12
117 0.12
118 0.12
119 0.11
120 0.12
121 0.11
122 0.14
123 0.09
124 0.09
125 0.09
126 0.12
127 0.11
128 0.12
129 0.12
130 0.1
131 0.09
132 0.1
133 0.09
134 0.09
135 0.09
136 0.1
137 0.14
138 0.15
139 0.15
140 0.15
141 0.16
142 0.13
143 0.13
144 0.14
145 0.11
146 0.11
147 0.12
148 0.13
149 0.12
150 0.15
151 0.18
152 0.16
153 0.17
154 0.18
155 0.18
156 0.17
157 0.17
158 0.15
159 0.12
160 0.15
161 0.15
162 0.12
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.08
169 0.08
170 0.08
171 0.09
172 0.13
173 0.13
174 0.13
175 0.18
176 0.18
177 0.19
178 0.21
179 0.25
180 0.27
181 0.34
182 0.37
183 0.38
184 0.41
185 0.41
186 0.45
187 0.42
188 0.41
189 0.39
190 0.44
191 0.41
192 0.43
193 0.47
194 0.51
195 0.58
196 0.6
197 0.65
198 0.66
199 0.74
200 0.79
201 0.83
202 0.84
203 0.8
204 0.82
205 0.83
206 0.82
207 0.82
208 0.82
209 0.78
210 0.7
211 0.65
212 0.59
213 0.52
214 0.44
215 0.39
216 0.33
217 0.28
218 0.28
219 0.26
220 0.24
221 0.2
222 0.18
223 0.12
224 0.09