Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JTE2

Protein Details
Accession A0A3N4JTE2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-90GDAAEFKVKEKRRKGKRKGKERKRKSVRGLKEVVVBasic
NLS Segment(s)
PositionSequence
62-84KVKEKRRKGKRKGKERKRKSVRG
Subcellular Location(s) plas 7, cyto 5, extr 5, E.R. 5, nucl 1, mito 1, pero 1, golg 1, vacu 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MLLAFFSFVFFFFFFFSSLSLPNVRIIAYVPFRVFGFSKIWEIVKTCVGLFVTVWGDAAEFKVKEKRRKGKRKGKERKRKSVRGLKEVVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.14
10 0.14
11 0.13
12 0.12
13 0.11
14 0.14
15 0.15
16 0.17
17 0.15
18 0.16
19 0.16
20 0.17
21 0.17
22 0.14
23 0.14
24 0.13
25 0.14
26 0.15
27 0.15
28 0.14
29 0.15
30 0.14
31 0.13
32 0.12
33 0.11
34 0.11
35 0.1
36 0.1
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.09
47 0.08
48 0.1
49 0.18
50 0.25
51 0.35
52 0.45
53 0.54
54 0.62
55 0.74
56 0.83
57 0.86
58 0.9
59 0.92
60 0.94
61 0.95
62 0.95
63 0.95
64 0.95
65 0.95
66 0.94
67 0.94
68 0.93
69 0.91
70 0.89
71 0.84