Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4J9E4

Protein Details
Accession A0A3N4J9E4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-95AEVEYKETRKRKPRRQRVSARDLPGBasic
NLS Segment(s)
PositionSequence
79-87RKRKPRRQR
150-163KREGRKATGLKALR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MPLKRKPLGNLVPNGTLRPLKKPKNPEMTVPTQEPSSHPTEHSTSPLAPHQIAHNTISPILQSPPPSFECAEVEYKETRKRKPRRQRVSARDLPGLPKYDPLDIPFEPYKAQVLLPEGSSLHPFDLFSLFWDDSVFEWLAVNTNLYAKSKREGRKATGLKALRRWKETTPGELRIFIGLVIKMALHKEARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.42
4 0.36
5 0.39
6 0.44
7 0.48
8 0.55
9 0.64
10 0.7
11 0.75
12 0.76
13 0.74
14 0.72
15 0.71
16 0.68
17 0.6
18 0.52
19 0.42
20 0.4
21 0.34
22 0.3
23 0.27
24 0.23
25 0.21
26 0.24
27 0.27
28 0.27
29 0.29
30 0.27
31 0.23
32 0.24
33 0.26
34 0.25
35 0.21
36 0.2
37 0.21
38 0.22
39 0.23
40 0.23
41 0.22
42 0.2
43 0.2
44 0.2
45 0.16
46 0.14
47 0.14
48 0.14
49 0.13
50 0.14
51 0.17
52 0.18
53 0.2
54 0.2
55 0.19
56 0.19
57 0.19
58 0.21
59 0.17
60 0.18
61 0.19
62 0.22
63 0.28
64 0.31
65 0.36
66 0.44
67 0.54
68 0.62
69 0.71
70 0.79
71 0.82
72 0.88
73 0.91
74 0.9
75 0.89
76 0.85
77 0.78
78 0.69
79 0.59
80 0.51
81 0.43
82 0.36
83 0.27
84 0.22
85 0.19
86 0.18
87 0.18
88 0.17
89 0.19
90 0.16
91 0.2
92 0.18
93 0.18
94 0.16
95 0.16
96 0.16
97 0.12
98 0.12
99 0.09
100 0.11
101 0.11
102 0.11
103 0.11
104 0.1
105 0.11
106 0.12
107 0.11
108 0.09
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.09
115 0.13
116 0.12
117 0.12
118 0.12
119 0.12
120 0.11
121 0.14
122 0.13
123 0.08
124 0.08
125 0.08
126 0.1
127 0.1
128 0.1
129 0.07
130 0.09
131 0.1
132 0.13
133 0.15
134 0.15
135 0.21
136 0.29
137 0.36
138 0.43
139 0.48
140 0.52
141 0.61
142 0.65
143 0.63
144 0.64
145 0.63
146 0.6
147 0.63
148 0.66
149 0.62
150 0.61
151 0.6
152 0.55
153 0.59
154 0.58
155 0.58
156 0.55
157 0.56
158 0.53
159 0.51
160 0.47
161 0.38
162 0.34
163 0.25
164 0.21
165 0.13
166 0.12
167 0.1
168 0.1
169 0.1
170 0.11
171 0.15