Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K4K0

Protein Details
Accession A0A3N4K4K0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-79RPADRNERAKVKRRKAQLRRLGARKLBasic
140-160GINRLRRKRKIVARMGQRNVRHydrophilic
NLS Segment(s)
PositionSequence
57-83DRNERAKVKRRKAQLRRLGARKLAAPA
145-150RRKRKI
Subcellular Location(s) cyto 14.5, cyto_nucl 11.5, nucl 7.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MEKHLPPPGIPCPFLKVGQCPYGDGCEYAHDFMAQPCLSSAQIDYQMRSLEHARPADRNERAKVKRRKAQLRRLGARKLAAPALFERGVVPTKKAIKRELGRYTVGPPNNITFLAVREKVFMDGGADDDDDDDGEWQTVGINRLRRKRKIVARMGQRNVRILGMSRRSGANVCYPFQFRWVAFVCNVSSQVVYGIDKHAGEPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.35
4 0.35
5 0.39
6 0.38
7 0.34
8 0.33
9 0.34
10 0.31
11 0.26
12 0.21
13 0.19
14 0.21
15 0.2
16 0.18
17 0.15
18 0.15
19 0.15
20 0.21
21 0.16
22 0.14
23 0.14
24 0.15
25 0.15
26 0.15
27 0.15
28 0.12
29 0.19
30 0.2
31 0.2
32 0.2
33 0.22
34 0.21
35 0.23
36 0.23
37 0.2
38 0.24
39 0.27
40 0.27
41 0.29
42 0.34
43 0.39
44 0.43
45 0.44
46 0.44
47 0.5
48 0.55
49 0.62
50 0.68
51 0.69
52 0.69
53 0.74
54 0.8
55 0.8
56 0.84
57 0.83
58 0.83
59 0.83
60 0.82
61 0.77
62 0.69
63 0.6
64 0.51
65 0.44
66 0.36
67 0.27
68 0.22
69 0.18
70 0.2
71 0.18
72 0.16
73 0.14
74 0.13
75 0.16
76 0.15
77 0.15
78 0.15
79 0.23
80 0.26
81 0.29
82 0.3
83 0.35
84 0.4
85 0.47
86 0.48
87 0.43
88 0.41
89 0.39
90 0.4
91 0.37
92 0.33
93 0.26
94 0.21
95 0.19
96 0.19
97 0.18
98 0.14
99 0.09
100 0.1
101 0.14
102 0.14
103 0.13
104 0.14
105 0.14
106 0.14
107 0.14
108 0.12
109 0.08
110 0.07
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.07
126 0.09
127 0.12
128 0.19
129 0.25
130 0.35
131 0.43
132 0.48
133 0.53
134 0.61
135 0.66
136 0.71
137 0.75
138 0.75
139 0.77
140 0.81
141 0.81
142 0.78
143 0.7
144 0.63
145 0.54
146 0.46
147 0.35
148 0.29
149 0.31
150 0.3
151 0.3
152 0.28
153 0.28
154 0.29
155 0.29
156 0.28
157 0.28
158 0.26
159 0.26
160 0.28
161 0.3
162 0.29
163 0.31
164 0.33
165 0.24
166 0.27
167 0.28
168 0.28
169 0.25
170 0.28
171 0.26
172 0.24
173 0.25
174 0.2
175 0.17
176 0.14
177 0.15
178 0.14
179 0.14
180 0.13
181 0.14
182 0.16
183 0.16
184 0.17