Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JK30

Protein Details
Accession A0A3N4JK30    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-98NSPTHPSRKKKSSTRQNKNKKKVYPQPFTHydrophilic
NLS Segment(s)
PositionSequence
76-91SRKKKSSTRQNKNKKK
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MPTIQLCVPDTSTIGRKVHSRYSSTSIHIQYFLQQPQQFPSPHPIPSHPIPSHRLIPAAQALITPRENHNSPTHPSRKKKSSTRQNKNKKKVYPQPFTHPALPATQQHTRKNLTPLLPPSRTRDSDFGQIHPRNLLTPAITDEKNRRVTTALGQTFFFLMFGEYGTVVSSSSVAYRKKSDWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.34
5 0.42
6 0.43
7 0.43
8 0.43
9 0.47
10 0.49
11 0.47
12 0.5
13 0.44
14 0.4
15 0.37
16 0.32
17 0.31
18 0.33
19 0.32
20 0.32
21 0.31
22 0.3
23 0.33
24 0.38
25 0.34
26 0.3
27 0.36
28 0.32
29 0.33
30 0.35
31 0.33
32 0.34
33 0.37
34 0.44
35 0.37
36 0.39
37 0.39
38 0.41
39 0.42
40 0.37
41 0.35
42 0.26
43 0.26
44 0.24
45 0.21
46 0.17
47 0.13
48 0.13
49 0.15
50 0.15
51 0.15
52 0.14
53 0.18
54 0.19
55 0.21
56 0.25
57 0.25
58 0.28
59 0.36
60 0.43
61 0.48
62 0.54
63 0.59
64 0.63
65 0.67
66 0.74
67 0.75
68 0.77
69 0.8
70 0.84
71 0.86
72 0.89
73 0.92
74 0.92
75 0.9
76 0.85
77 0.83
78 0.82
79 0.81
80 0.79
81 0.72
82 0.7
83 0.68
84 0.65
85 0.57
86 0.49
87 0.4
88 0.32
89 0.31
90 0.25
91 0.24
92 0.28
93 0.31
94 0.34
95 0.38
96 0.38
97 0.4
98 0.41
99 0.41
100 0.36
101 0.36
102 0.39
103 0.43
104 0.44
105 0.42
106 0.44
107 0.46
108 0.46
109 0.44
110 0.41
111 0.37
112 0.42
113 0.42
114 0.39
115 0.42
116 0.42
117 0.39
118 0.36
119 0.33
120 0.25
121 0.25
122 0.23
123 0.14
124 0.13
125 0.16
126 0.18
127 0.19
128 0.22
129 0.26
130 0.33
131 0.4
132 0.38
133 0.36
134 0.34
135 0.35
136 0.39
137 0.43
138 0.4
139 0.33
140 0.33
141 0.33
142 0.31
143 0.29
144 0.21
145 0.11
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.07
156 0.07
157 0.06
158 0.1
159 0.15
160 0.18
161 0.22
162 0.26