Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JIJ5

Protein Details
Accession A0A3N4JIJ5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-74GKESRQGERKGKEKKKWNGKAGKESGQGBasic
NLS Segment(s)
PositionSequence
6-75GRRGWERRRIREDKGEREGEGKGEEGRGLERKGVRKWARKVGKESRQGERKGKEKKKWNGKAGKESGQGK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MREEGGRRGWERRRIREDKGEREGEGKGEEGRGLERKGVRKWARKVGKESRQGERKGKEKKKWNGKAGKESGQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.78
4 0.78
5 0.77
6 0.76
7 0.68
8 0.58
9 0.54
10 0.47
11 0.38
12 0.29
13 0.21
14 0.14
15 0.12
16 0.11
17 0.09
18 0.11
19 0.12
20 0.12
21 0.14
22 0.17
23 0.21
24 0.23
25 0.32
26 0.37
27 0.43
28 0.48
29 0.56
30 0.61
31 0.61
32 0.69
33 0.69
34 0.71
35 0.72
36 0.71
37 0.7
38 0.7
39 0.7
40 0.7
41 0.66
42 0.66
43 0.67
44 0.73
45 0.73
46 0.75
47 0.8
48 0.83
49 0.87
50 0.88
51 0.87
52 0.86
53 0.87
54 0.84
55 0.82