Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KDP6

Protein Details
Accession A0A3N4KDP6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
12-33QPNGCLHPSKRRKISEERKSLSHydrophilic
NLS Segment(s)
PositionSequence
22-24RRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
Amino Acid Sequences MPSKRRPLAEVQPNGCLHPSKRRKISEERKSLSSKPNGPPSKSSTFPLHPTPAYPSSNKSAKPNSPDSPTEKDPAQSAQLPSSFEPPVVEVPVVKGSKRQRISARDLPDLPTYNPVEVPFEPHNARVSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.42
4 0.35
5 0.37
6 0.44
7 0.46
8 0.55
9 0.6
10 0.65
11 0.72
12 0.8
13 0.8
14 0.81
15 0.76
16 0.72
17 0.71
18 0.69
19 0.66
20 0.63
21 0.6
22 0.56
23 0.62
24 0.62
25 0.59
26 0.59
27 0.57
28 0.55
29 0.49
30 0.45
31 0.41
32 0.38
33 0.39
34 0.39
35 0.36
36 0.3
37 0.29
38 0.31
39 0.3
40 0.29
41 0.26
42 0.25
43 0.27
44 0.31
45 0.31
46 0.31
47 0.32
48 0.33
49 0.37
50 0.41
51 0.38
52 0.39
53 0.4
54 0.4
55 0.4
56 0.39
57 0.35
58 0.3
59 0.27
60 0.24
61 0.23
62 0.2
63 0.18
64 0.16
65 0.17
66 0.18
67 0.19
68 0.18
69 0.2
70 0.18
71 0.15
72 0.14
73 0.13
74 0.13
75 0.12
76 0.12
77 0.08
78 0.1
79 0.17
80 0.17
81 0.15
82 0.21
83 0.27
84 0.36
85 0.39
86 0.44
87 0.46
88 0.52
89 0.61
90 0.62
91 0.62
92 0.59
93 0.57
94 0.54
95 0.51
96 0.47
97 0.39
98 0.37
99 0.33
100 0.28
101 0.28
102 0.25
103 0.25
104 0.22
105 0.27
106 0.24
107 0.28
108 0.29
109 0.3
110 0.35