Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JSY7

Protein Details
Accession A0A3N4JSY7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRKKAKKTKNIQYDISFHydrophilic
NLS Segment(s)
PositionSequence
3-12KKRKKAKKTK
Subcellular Location(s) extr 9, golg 6, mito 5, plas 3, vacu 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTKKRKKAKKTKNIQYDISFILPPLFFLAFSFLSISDLSPPLGLWSSLGAPHGATVKSHRCACCTFKVALFSFFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.68
4 0.6
5 0.51
6 0.4
7 0.29
8 0.25
9 0.18
10 0.15
11 0.13
12 0.1
13 0.08
14 0.08
15 0.11
16 0.09
17 0.1
18 0.1
19 0.08
20 0.09
21 0.09
22 0.09
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.07
39 0.09
40 0.09
41 0.09
42 0.15
43 0.21
44 0.27
45 0.33
46 0.33
47 0.34
48 0.39
49 0.43
50 0.45
51 0.43
52 0.4
53 0.37
54 0.43
55 0.41