Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JCV0

Protein Details
Accession A0A3N4JCV0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-153LKPKAGARIRKQKTKKKNIVRGLKGKMBasic
NLS Segment(s)
PositionSequence
76-89APRAVPAGPPRRSA
108-208PRKHKKEPGKTAAGTKSPILKPKAGARIRKQKTKKKNIVRGLKGKMAKKALLEEEEAEKEKKENAKMAARMTGGGGRASRKSAARAFQGAAIRLPKWWKKG
Subcellular Location(s) nucl 16, cyto 6, pero 3
Family & Domain DBs
Amino Acid Sequences MKTNNPNTTAPKDIAEAPTTSPEDTDNDSNQGSKPSPELMNTVQILMDKVEEAPNPGSNAAPTATPQTTKVPRQRAPRAVPAGPPRRSARHIKEVQESSQDEPTIISPRKHKKEPGKTAAGTKSPILKPKAGARIRKQKTKKKNIVRGLKGKMAKKALLEEEEAEKEKKENAKMAARMTGGGGRASRKSAARAFQGAAIRLPKWWKKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.26
4 0.23
5 0.27
6 0.27
7 0.25
8 0.21
9 0.19
10 0.2
11 0.24
12 0.26
13 0.22
14 0.23
15 0.24
16 0.24
17 0.24
18 0.25
19 0.21
20 0.18
21 0.19
22 0.2
23 0.21
24 0.21
25 0.25
26 0.23
27 0.27
28 0.26
29 0.24
30 0.21
31 0.19
32 0.19
33 0.14
34 0.13
35 0.07
36 0.08
37 0.1
38 0.1
39 0.12
40 0.13
41 0.15
42 0.15
43 0.15
44 0.15
45 0.12
46 0.13
47 0.11
48 0.09
49 0.08
50 0.12
51 0.12
52 0.13
53 0.15
54 0.21
55 0.26
56 0.34
57 0.41
58 0.45
59 0.5
60 0.59
61 0.66
62 0.67
63 0.67
64 0.67
65 0.65
66 0.58
67 0.57
68 0.58
69 0.58
70 0.51
71 0.51
72 0.45
73 0.44
74 0.47
75 0.5
76 0.48
77 0.49
78 0.52
79 0.51
80 0.55
81 0.53
82 0.5
83 0.47
84 0.41
85 0.33
86 0.3
87 0.25
88 0.18
89 0.16
90 0.16
91 0.17
92 0.17
93 0.17
94 0.23
95 0.32
96 0.39
97 0.42
98 0.49
99 0.53
100 0.62
101 0.7
102 0.7
103 0.67
104 0.62
105 0.64
106 0.6
107 0.52
108 0.42
109 0.33
110 0.33
111 0.28
112 0.33
113 0.3
114 0.28
115 0.29
116 0.34
117 0.43
118 0.42
119 0.48
120 0.51
121 0.59
122 0.64
123 0.71
124 0.74
125 0.74
126 0.8
127 0.83
128 0.85
129 0.85
130 0.89
131 0.88
132 0.89
133 0.88
134 0.86
135 0.8
136 0.76
137 0.72
138 0.65
139 0.62
140 0.56
141 0.49
142 0.42
143 0.41
144 0.38
145 0.34
146 0.31
147 0.27
148 0.26
149 0.27
150 0.28
151 0.23
152 0.2
153 0.19
154 0.23
155 0.27
156 0.26
157 0.29
158 0.33
159 0.41
160 0.44
161 0.45
162 0.45
163 0.39
164 0.36
165 0.32
166 0.28
167 0.21
168 0.2
169 0.19
170 0.18
171 0.19
172 0.22
173 0.24
174 0.24
175 0.29
176 0.33
177 0.37
178 0.39
179 0.41
180 0.39
181 0.41
182 0.42
183 0.38
184 0.36
185 0.34
186 0.29
187 0.29
188 0.37
189 0.38