Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3K4

Protein Details
Accession A0A3N4K3K4    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
334-360QGESKNAARKRMKEERKLAKIKKRRDABasic
NLS Segment(s)
PositionSequence
339-360NAARKRMKEERKLAKIKKRRDA
Subcellular Location(s) mito 21.5, mito_nucl 12.666, cyto_nucl 3.333, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
CDD cd01856  YlqF  
Amino Acid Sequences MKLPPARSIISPARSLSIPSKLAPSVGLPNIQDSSFVPRQEFPYPSNLITSYFLGHHRAGLDRMKQLVSSVELIIECRDYRVPLSSRNPMFEETLQEKERLIVYTKRDLAAEELDLKVCQKFPLTNTPNRDSIFCPLPPAYAYTATAADNMIGSRMLVVGMPNVGKSTLLNAMRRVGTGNSKKAAITGGQPGVTRKISMTVKISDDPLVYLLDSPGVFVPYMPNPQTMLSLALVGCVKDSLLNPTTLADYLLFHLNLRDPSLYSSYCPPTNDIVELLTATAKATGRLLKGGTPDFDATAYWLIQRYRAGVLGKFILDDVSETAYQTWLDAEENQGESKNAARKRMKEERKLAKIKKRRDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.34
4 0.33
5 0.31
6 0.29
7 0.32
8 0.29
9 0.29
10 0.27
11 0.25
12 0.25
13 0.25
14 0.27
15 0.23
16 0.26
17 0.27
18 0.26
19 0.23
20 0.18
21 0.25
22 0.25
23 0.26
24 0.26
25 0.27
26 0.31
27 0.36
28 0.38
29 0.31
30 0.34
31 0.36
32 0.35
33 0.35
34 0.31
35 0.27
36 0.26
37 0.25
38 0.2
39 0.18
40 0.2
41 0.21
42 0.21
43 0.2
44 0.19
45 0.2
46 0.22
47 0.27
48 0.29
49 0.29
50 0.31
51 0.3
52 0.28
53 0.27
54 0.25
55 0.21
56 0.18
57 0.15
58 0.14
59 0.13
60 0.14
61 0.14
62 0.13
63 0.11
64 0.11
65 0.12
66 0.12
67 0.13
68 0.2
69 0.21
70 0.27
71 0.33
72 0.4
73 0.41
74 0.43
75 0.44
76 0.39
77 0.4
78 0.33
79 0.33
80 0.28
81 0.32
82 0.3
83 0.28
84 0.26
85 0.25
86 0.25
87 0.2
88 0.21
89 0.2
90 0.23
91 0.3
92 0.32
93 0.31
94 0.3
95 0.29
96 0.27
97 0.24
98 0.21
99 0.15
100 0.14
101 0.14
102 0.13
103 0.14
104 0.12
105 0.11
106 0.1
107 0.1
108 0.12
109 0.14
110 0.26
111 0.3
112 0.36
113 0.42
114 0.45
115 0.47
116 0.46
117 0.44
118 0.35
119 0.34
120 0.31
121 0.25
122 0.24
123 0.2
124 0.2
125 0.19
126 0.19
127 0.16
128 0.14
129 0.14
130 0.12
131 0.13
132 0.12
133 0.12
134 0.1
135 0.08
136 0.07
137 0.06
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.11
156 0.14
157 0.15
158 0.16
159 0.19
160 0.19
161 0.19
162 0.18
163 0.14
164 0.19
165 0.23
166 0.25
167 0.24
168 0.24
169 0.24
170 0.23
171 0.23
172 0.15
173 0.13
174 0.13
175 0.13
176 0.14
177 0.15
178 0.15
179 0.17
180 0.16
181 0.15
182 0.11
183 0.16
184 0.15
185 0.18
186 0.2
187 0.19
188 0.21
189 0.22
190 0.23
191 0.18
192 0.17
193 0.15
194 0.12
195 0.1
196 0.08
197 0.07
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.08
207 0.09
208 0.13
209 0.14
210 0.14
211 0.14
212 0.15
213 0.16
214 0.14
215 0.14
216 0.1
217 0.1
218 0.09
219 0.1
220 0.1
221 0.09
222 0.08
223 0.06
224 0.06
225 0.06
226 0.07
227 0.11
228 0.12
229 0.13
230 0.13
231 0.14
232 0.15
233 0.13
234 0.13
235 0.08
236 0.08
237 0.09
238 0.12
239 0.11
240 0.1
241 0.11
242 0.13
243 0.13
244 0.15
245 0.14
246 0.12
247 0.15
248 0.18
249 0.18
250 0.17
251 0.22
252 0.24
253 0.26
254 0.26
255 0.26
256 0.26
257 0.27
258 0.26
259 0.21
260 0.17
261 0.15
262 0.14
263 0.12
264 0.09
265 0.07
266 0.06
267 0.09
268 0.08
269 0.09
270 0.11
271 0.14
272 0.15
273 0.17
274 0.18
275 0.17
276 0.22
277 0.23
278 0.22
279 0.22
280 0.22
281 0.2
282 0.2
283 0.17
284 0.15
285 0.14
286 0.13
287 0.11
288 0.14
289 0.14
290 0.16
291 0.17
292 0.18
293 0.18
294 0.21
295 0.23
296 0.2
297 0.23
298 0.23
299 0.22
300 0.2
301 0.18
302 0.15
303 0.12
304 0.12
305 0.1
306 0.11
307 0.11
308 0.11
309 0.12
310 0.13
311 0.12
312 0.11
313 0.11
314 0.08
315 0.09
316 0.1
317 0.12
318 0.15
319 0.17
320 0.17
321 0.18
322 0.17
323 0.17
324 0.22
325 0.27
326 0.27
327 0.36
328 0.43
329 0.49
330 0.58
331 0.69
332 0.73
333 0.76
334 0.82
335 0.83
336 0.87
337 0.9
338 0.9
339 0.9
340 0.9