Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K2X1

Protein Details
Accession A0A3N4K2X1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-87TLKPPPLPMTTRKKRNKNTLMTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MQRKISQPTAAQNLRPPLNVFPVEIPNHTLEPDTCRFFTGEEAAIRRILDTFLTVIERTNQDKTTLKPPPLPMTTRKKRNKNTLMTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.39
4 0.32
5 0.34
6 0.33
7 0.28
8 0.24
9 0.27
10 0.27
11 0.25
12 0.25
13 0.21
14 0.21
15 0.2
16 0.18
17 0.13
18 0.17
19 0.2
20 0.2
21 0.18
22 0.19
23 0.19
24 0.18
25 0.19
26 0.15
27 0.14
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.12
34 0.1
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.1
44 0.13
45 0.15
46 0.18
47 0.18
48 0.2
49 0.23
50 0.26
51 0.33
52 0.37
53 0.38
54 0.4
55 0.44
56 0.48
57 0.5
58 0.51
59 0.51
60 0.55
61 0.62
62 0.68
63 0.73
64 0.76
65 0.82
66 0.89
67 0.9