Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JED5

Protein Details
Accession A0A3N4JED5    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-80DIVPLPKIKRRKKATVPPKKRPNRSCLHydrophilic
109-129TGKTRKGSKKLGKKATRSGNIHydrophilic
NLS Segment(s)
PositionSequence
59-76PKIKRRKKATVPPKKRPN
110-124GKTRKGSKKLGKKAT
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAWESEQTVTSLNESVIIHNSMTAPEAEAEGALSAAGGVIRYNIRPREGQLKEDIVPLPKIKRRKKATVPPKKRPNRSCLLSVAPDKTADSLGNSGDETDSSRASASGTGKTRKGSKKLGKKATRSGNIEDILKKGSESFFPSSQSEELTSSTHEGAKGHVLSRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.17
5 0.15
6 0.15
7 0.15
8 0.12
9 0.13
10 0.11
11 0.09
12 0.08
13 0.09
14 0.08
15 0.07
16 0.07
17 0.06
18 0.06
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.05
27 0.06
28 0.08
29 0.14
30 0.16
31 0.18
32 0.2
33 0.23
34 0.31
35 0.32
36 0.33
37 0.32
38 0.33
39 0.32
40 0.33
41 0.32
42 0.23
43 0.24
44 0.23
45 0.25
46 0.26
47 0.36
48 0.41
49 0.5
50 0.55
51 0.63
52 0.7
53 0.75
54 0.82
55 0.83
56 0.86
57 0.86
58 0.89
59 0.89
60 0.89
61 0.84
62 0.8
63 0.76
64 0.7
65 0.62
66 0.55
67 0.48
68 0.42
69 0.39
70 0.33
71 0.25
72 0.22
73 0.18
74 0.16
75 0.13
76 0.1
77 0.08
78 0.08
79 0.07
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.07
89 0.08
90 0.07
91 0.08
92 0.11
93 0.11
94 0.15
95 0.2
96 0.23
97 0.25
98 0.28
99 0.36
100 0.4
101 0.44
102 0.49
103 0.54
104 0.62
105 0.7
106 0.78
107 0.78
108 0.78
109 0.81
110 0.8
111 0.79
112 0.72
113 0.66
114 0.62
115 0.55
116 0.52
117 0.44
118 0.35
119 0.29
120 0.25
121 0.2
122 0.16
123 0.15
124 0.15
125 0.19
126 0.23
127 0.23
128 0.26
129 0.27
130 0.29
131 0.28
132 0.27
133 0.23
134 0.2
135 0.19
136 0.17
137 0.18
138 0.17
139 0.18
140 0.18
141 0.17
142 0.16
143 0.17
144 0.22
145 0.22
146 0.22