Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JP70

Protein Details
Accession A0A3N4JP70   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-118ECLNRANEEAHKKKRKRKEREKKKRKRASDSBasic
NLS Segment(s)
PositionSequence
98-115HKKKRKRKEREKKKRKRA
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MKRKGKYTVYYDNIRIFDYPVTTLGFGTSFLSFGLDSNLSHKADITITPLSFAQHSPELTEQEEEGKEKSKTIQLPPAKKRTLQMHHECLNRANEEAHKKKRKRKEREKKKRKRASDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.32
4 0.27
5 0.23
6 0.19
7 0.15
8 0.15
9 0.14
10 0.13
11 0.12
12 0.11
13 0.1
14 0.1
15 0.09
16 0.07
17 0.07
18 0.08
19 0.07
20 0.07
21 0.09
22 0.08
23 0.08
24 0.1
25 0.14
26 0.14
27 0.14
28 0.14
29 0.12
30 0.12
31 0.13
32 0.14
33 0.12
34 0.12
35 0.13
36 0.13
37 0.12
38 0.12
39 0.12
40 0.11
41 0.1
42 0.11
43 0.11
44 0.12
45 0.13
46 0.13
47 0.14
48 0.11
49 0.11
50 0.12
51 0.11
52 0.1
53 0.13
54 0.12
55 0.12
56 0.14
57 0.17
58 0.2
59 0.23
60 0.31
61 0.35
62 0.45
63 0.52
64 0.59
65 0.56
66 0.54
67 0.56
68 0.57
69 0.58
70 0.58
71 0.59
72 0.58
73 0.62
74 0.63
75 0.59
76 0.54
77 0.5
78 0.41
79 0.34
80 0.29
81 0.29
82 0.36
83 0.44
84 0.5
85 0.57
86 0.64
87 0.73
88 0.82
89 0.86
90 0.87
91 0.9
92 0.91
93 0.92
94 0.95
95 0.97
96 0.97
97 0.98
98 0.97