Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JKN8

Protein Details
Accession A0A3N4JKN8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
275-299TTPITRTTPERKRKKSGFLRRDTVGHydrophilic
NLS Segment(s)
PositionSequence
286-289KRKK
Subcellular Location(s) nucl 11.5, cyto_nucl 11.333, cyto 10, cyto_mito 7.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSFGHDSILSSGSSGSREGLAMNWVLDHVLAYPATYDFALPLRTIYTLNSTTPHTSPADFKLLLLEHISNLPSQPCTLPPSFLSTFVRKCFPQDLENVQFDQALTALDYIRDLEIRRSKELEKAARARGEADRRIVNLRIKSIRTEQFYARAIAGIRRWTLLHELSITPFNKFNCIAILNTLYPIEEADINSYLPAPTLASQRHALWRYITGVEKNGPGILESVRTSNGGWAGVSEAVNAYLRLSLDMIHKADELARPSSIGSFRSDDSMDLGATTPITRTTPERKRKKSGFLRRDTVGSETSEEEGGGKASTLERIVRGLARLGSSQHLGSPKKLYESDAGSEEEFRMRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.11
6 0.11
7 0.12
8 0.12
9 0.11
10 0.1
11 0.1
12 0.1
13 0.09
14 0.08
15 0.07
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.09
23 0.09
24 0.08
25 0.1
26 0.11
27 0.1
28 0.11
29 0.11
30 0.12
31 0.13
32 0.13
33 0.17
34 0.18
35 0.19
36 0.2
37 0.22
38 0.25
39 0.25
40 0.27
41 0.23
42 0.23
43 0.25
44 0.27
45 0.3
46 0.26
47 0.25
48 0.26
49 0.25
50 0.24
51 0.23
52 0.19
53 0.14
54 0.15
55 0.16
56 0.12
57 0.13
58 0.13
59 0.12
60 0.12
61 0.13
62 0.13
63 0.19
64 0.19
65 0.2
66 0.2
67 0.26
68 0.26
69 0.29
70 0.31
71 0.31
72 0.35
73 0.35
74 0.38
75 0.31
76 0.34
77 0.36
78 0.34
79 0.32
80 0.33
81 0.38
82 0.4
83 0.42
84 0.39
85 0.33
86 0.3
87 0.26
88 0.21
89 0.13
90 0.08
91 0.06
92 0.06
93 0.06
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.08
100 0.14
101 0.21
102 0.24
103 0.26
104 0.29
105 0.3
106 0.34
107 0.41
108 0.4
109 0.42
110 0.44
111 0.46
112 0.45
113 0.44
114 0.41
115 0.4
116 0.41
117 0.36
118 0.33
119 0.31
120 0.3
121 0.33
122 0.34
123 0.32
124 0.27
125 0.3
126 0.31
127 0.3
128 0.32
129 0.36
130 0.37
131 0.36
132 0.37
133 0.33
134 0.33
135 0.34
136 0.32
137 0.25
138 0.21
139 0.17
140 0.16
141 0.17
142 0.15
143 0.14
144 0.13
145 0.13
146 0.13
147 0.16
148 0.15
149 0.13
150 0.12
151 0.12
152 0.13
153 0.18
154 0.17
155 0.15
156 0.17
157 0.16
158 0.17
159 0.17
160 0.16
161 0.12
162 0.13
163 0.12
164 0.11
165 0.13
166 0.1
167 0.11
168 0.1
169 0.08
170 0.07
171 0.07
172 0.06
173 0.05
174 0.05
175 0.06
176 0.07
177 0.07
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.05
184 0.06
185 0.1
186 0.11
187 0.13
188 0.15
189 0.16
190 0.23
191 0.24
192 0.23
193 0.2
194 0.21
195 0.21
196 0.22
197 0.22
198 0.17
199 0.17
200 0.18
201 0.17
202 0.16
203 0.14
204 0.12
205 0.1
206 0.1
207 0.08
208 0.09
209 0.09
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.11
216 0.09
217 0.08
218 0.07
219 0.08
220 0.09
221 0.09
222 0.07
223 0.07
224 0.07
225 0.08
226 0.08
227 0.07
228 0.06
229 0.07
230 0.07
231 0.07
232 0.08
233 0.1
234 0.14
235 0.14
236 0.14
237 0.14
238 0.14
239 0.16
240 0.17
241 0.18
242 0.16
243 0.15
244 0.15
245 0.15
246 0.18
247 0.18
248 0.16
249 0.16
250 0.17
251 0.17
252 0.2
253 0.2
254 0.17
255 0.17
256 0.17
257 0.13
258 0.12
259 0.12
260 0.09
261 0.09
262 0.09
263 0.07
264 0.07
265 0.08
266 0.1
267 0.15
268 0.25
269 0.35
270 0.46
271 0.56
272 0.63
273 0.73
274 0.79
275 0.84
276 0.85
277 0.86
278 0.86
279 0.84
280 0.82
281 0.74
282 0.69
283 0.6
284 0.52
285 0.43
286 0.34
287 0.27
288 0.23
289 0.22
290 0.19
291 0.17
292 0.14
293 0.12
294 0.11
295 0.09
296 0.07
297 0.07
298 0.08
299 0.1
300 0.11
301 0.13
302 0.13
303 0.14
304 0.17
305 0.17
306 0.18
307 0.19
308 0.19
309 0.2
310 0.2
311 0.21
312 0.22
313 0.22
314 0.21
315 0.22
316 0.28
317 0.28
318 0.3
319 0.35
320 0.34
321 0.38
322 0.39
323 0.38
324 0.36
325 0.39
326 0.39
327 0.35
328 0.34
329 0.3
330 0.3
331 0.28
332 0.26