Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JAY3

Protein Details
Accession A0A3N4JAY3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-52INSLKSVTKRSKRNKITKKRWWEIIIHydrophilic
NLS Segment(s)
PositionSequence
35-45KRSKRNKITKK
Subcellular Location(s) mito 13, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MIAGPTFLFYSSAVNVTGALNWSEGGINSLKSVTKRSKRNKITKKRWWEIIINYGINPKTLRTDILPPPKSSTLFSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.1
6 0.09
7 0.08
8 0.07
9 0.08
10 0.07
11 0.07
12 0.08
13 0.08
14 0.07
15 0.07
16 0.08
17 0.09
18 0.1
19 0.15
20 0.22
21 0.29
22 0.39
23 0.49
24 0.58
25 0.67
26 0.77
27 0.83
28 0.85
29 0.88
30 0.88
31 0.89
32 0.84
33 0.81
34 0.74
35 0.68
36 0.61
37 0.58
38 0.52
39 0.42
40 0.37
41 0.34
42 0.3
43 0.27
44 0.24
45 0.17
46 0.17
47 0.17
48 0.19
49 0.18
50 0.25
51 0.33
52 0.44
53 0.47
54 0.44
55 0.5
56 0.52
57 0.5
58 0.45