Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KCK0

Protein Details
Accession A0A3N4KCK0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-64LPLTRGKKKREREETIDKKRERBasic
NLS Segment(s)
PositionSequence
47-64RGKKKREREETIDKKRER
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MWWSNLCTSLWNINPTPEAQNSRNLGNPTNLENPNPYPPKIHLPLTRGKKKREREETIDKKRERAENIPPTKPLPSINNTTTATHKTLQTTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.28
5 0.31
6 0.28
7 0.34
8 0.34
9 0.35
10 0.37
11 0.35
12 0.32
13 0.29
14 0.29
15 0.26
16 0.31
17 0.3
18 0.27
19 0.28
20 0.28
21 0.33
22 0.34
23 0.3
24 0.25
25 0.26
26 0.32
27 0.32
28 0.36
29 0.31
30 0.32
31 0.39
32 0.46
33 0.54
34 0.52
35 0.56
36 0.6
37 0.65
38 0.72
39 0.74
40 0.72
41 0.71
42 0.77
43 0.8
44 0.82
45 0.83
46 0.73
47 0.67
48 0.66
49 0.63
50 0.57
51 0.52
52 0.52
53 0.53
54 0.59
55 0.58
56 0.54
57 0.51
58 0.48
59 0.44
60 0.37
61 0.33
62 0.31
63 0.35
64 0.35
65 0.39
66 0.39
67 0.4
68 0.4
69 0.38
70 0.37
71 0.33
72 0.34