Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4J1D1

Protein Details
Accession A0A3N4J1D1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-106NPSHRVRKRRLGFLARKRTPGGRGVLKRRRAKGRKSLTHBasic
NLS Segment(s)
PositionSequence
71-103HRVRKRRLGFLARKRTPGGRGVLKRRRAKGRKS
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences PTNNRTIVTKSTPLRPSFSFLPTGLVPATPGVAAGPALGMMQSLMAKISSNPGLLGVQVRCGPRNTFNPSHRVRKRRLGFLARKRTPGGRGVLKRRRAKGRKSLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.47
4 0.42
5 0.41
6 0.36
7 0.29
8 0.31
9 0.26
10 0.26
11 0.2
12 0.16
13 0.14
14 0.11
15 0.11
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.02
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.1
43 0.08
44 0.08
45 0.11
46 0.12
47 0.13
48 0.15
49 0.17
50 0.19
51 0.26
52 0.32
53 0.36
54 0.38
55 0.46
56 0.5
57 0.59
58 0.62
59 0.63
60 0.62
61 0.65
62 0.68
63 0.69
64 0.72
65 0.72
66 0.74
67 0.77
68 0.82
69 0.76
70 0.74
71 0.68
72 0.63
73 0.56
74 0.51
75 0.48
76 0.47
77 0.52
78 0.59
79 0.65
80 0.71
81 0.76
82 0.79
83 0.83
84 0.82
85 0.83
86 0.83