Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JR16

Protein Details
Accession A0A3N4JR16    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65IFKKRYQKAVWKRKRIPRNMEEHydrophilic
NLS Segment(s)
PositionSequence
52-58AVWKRKR
Subcellular Location(s) cyto 9.5, cyto_nucl 9.5, nucl 8.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MVEDGVSYHTSEYTTKHQIQLSIKCMDWPLHSPDLNPIENVWGIFKKRYQKAVWKRKRIPRNMEELIGLAQEVWSALPWGRIYGWIDRIPERVNFCLRRNGGPTQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.33
4 0.34
5 0.39
6 0.45
7 0.48
8 0.46
9 0.41
10 0.38
11 0.35
12 0.35
13 0.31
14 0.26
15 0.23
16 0.24
17 0.26
18 0.27
19 0.26
20 0.31
21 0.34
22 0.31
23 0.28
24 0.22
25 0.19
26 0.19
27 0.18
28 0.13
29 0.11
30 0.12
31 0.13
32 0.17
33 0.23
34 0.27
35 0.32
36 0.34
37 0.42
38 0.52
39 0.62
40 0.68
41 0.7
42 0.75
43 0.79
44 0.85
45 0.83
46 0.82
47 0.76
48 0.75
49 0.67
50 0.59
51 0.5
52 0.41
53 0.33
54 0.23
55 0.17
56 0.08
57 0.06
58 0.04
59 0.04
60 0.03
61 0.03
62 0.04
63 0.05
64 0.07
65 0.07
66 0.09
67 0.09
68 0.12
69 0.14
70 0.18
71 0.22
72 0.23
73 0.26
74 0.26
75 0.3
76 0.29
77 0.31
78 0.32
79 0.31
80 0.37
81 0.4
82 0.42
83 0.48
84 0.49
85 0.51
86 0.51