Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JUD2

Protein Details
Accession A0A3N4JUD2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-46PRDPRALRINRKFNKKKKAEBasic
NLS Segment(s)
PositionSequence
33-45LRINRKFNKKKKA
Subcellular Location(s) mito 13, extr 5, cyto 4, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MIKVRLGLWFAGHCVFFASGNSTHACPRDPRALRINRKFNKKKKAEGTGNRTRDTDTLIWPSIVVVHKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.13
6 0.12
7 0.14
8 0.15
9 0.14
10 0.16
11 0.17
12 0.18
13 0.16
14 0.19
15 0.28
16 0.28
17 0.32
18 0.39
19 0.47
20 0.55
21 0.62
22 0.68
23 0.65
24 0.74
25 0.8
26 0.79
27 0.81
28 0.77
29 0.77
30 0.75
31 0.79
32 0.78
33 0.78
34 0.79
35 0.78
36 0.77
37 0.7
38 0.62
39 0.54
40 0.44
41 0.4
42 0.33
43 0.27
44 0.28
45 0.27
46 0.26
47 0.24
48 0.24
49 0.23
50 0.23